Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 367507..368297 | Replicon | plasmid pAt13-2099-1-2a |
| Accession | NZ_CP110833 | ||
| Organism | Agrobacterium sp. 13-2099-1-2 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A9E8LKX9 |
| Locus tag | A6U84_RS24465 | Protein ID | WP_035200888.1 |
| Coordinates | 367800..368297 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
| Locus tag | A6U84_RS24460 | Protein ID | WP_019565754.1 |
| Coordinates | 367507..367803 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6U84_RS24440 (A6U84_24440) | 362920..364644 | + | 1725 | WP_003517188.1 | ABC transporter ATP-binding protein | - |
| A6U84_RS24445 (A6U84_24445) | 364689..365876 | + | 1188 | WP_065703164.1 | galactarate dehydratase | - |
| A6U84_RS24450 (A6U84_24450) | 365863..366729 | + | 867 | WP_065703249.1 | aldose 1-epimerase | - |
| A6U84_RS24455 (A6U84_24455) | 366939..367268 | + | 330 | Protein_340 | DDE-type integrase/transposase/recombinase | - |
| A6U84_RS24460 (A6U84_24460) | 367507..367803 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
| A6U84_RS24465 (A6U84_24465) | 367800..368297 | + | 498 | WP_035200888.1 | GNAT family N-acetyltransferase | Toxin |
| A6U84_RS24470 (A6U84_24470) | 368668..368925 | - | 258 | Protein_343 | DoxX family protein | - |
| A6U84_RS24475 (A6U84_24475) | 368942..369349 | + | 408 | Protein_344 | SDR family NAD(P)-dependent oxidoreductase | - |
| A6U84_RS24480 (A6U84_24480) | 369515..369766 | + | 252 | Protein_345 | CopG family transcriptional regulator | - |
| A6U84_RS24485 (A6U84_24485) | 369958..370470 | + | 513 | WP_065703168.1 | RNA polymerase sigma factor | - |
| A6U84_RS24490 (A6U84_24490) | 370593..371546 | + | 954 | WP_065703170.1 | FecR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..611263 | 611263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17726.26 Da Isoelectric Point: 6.4803
>T264369 WP_035200888.1 NZ_CP110833:367800-368297 [Agrobacterium sp. 13-2099-1-2]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLD
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLD
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|