Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 355026..355696 | Replicon | plasmid pAt13-2099-1-2a |
| Accession | NZ_CP110833 | ||
| Organism | Agrobacterium sp. 13-2099-1-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A9E8LLV6 |
| Locus tag | A6U84_RS24405 | Protein ID | WP_065662736.1 |
| Coordinates | 355277..355696 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A9E8LL22 |
| Locus tag | A6U84_RS24400 | Protein ID | WP_065703160.1 |
| Coordinates | 355026..355280 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6U84_RS24390 (A6U84_24390) | 352322..353329 | + | 1008 | WP_065703158.1 | sensor histidine kinase | - |
| A6U84_RS24395 (A6U84_24395) | 354040..354645 | - | 606 | WP_065703247.1 | J domain-containing protein | - |
| A6U84_RS24400 (A6U84_24400) | 355026..355280 | + | 255 | WP_065703160.1 | plasmid stabilization protein | Antitoxin |
| A6U84_RS24405 (A6U84_24405) | 355277..355696 | + | 420 | WP_065662736.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| A6U84_RS24410 (A6U84_24410) | 355836..356732 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
| A6U84_RS24415 (A6U84_24415) | 356765..357646 | - | 882 | WP_065662737.1 | SMP-30/gluconolactonase/LRE family protein | - |
| A6U84_RS24420 (A6U84_24420) | 357702..358421 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
| A6U84_RS24425 (A6U84_24425) | 358721..360670 | + | 1950 | WP_065703162.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..611263 | 611263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15050.25 Da Isoelectric Point: 5.1532
>T264368 WP_065662736.1 NZ_CP110833:355277-355696 [Agrobacterium sp. 13-2099-1-2]
MILLDTNVISEPWKPIPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPIPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|