Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3763975..3764632 | Replicon | chromosome |
| Accession | NZ_CP110823 | ||
| Organism | Enterobacter roggenkampii strain WS22-2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | OM419_RS17580 | Protein ID | WP_021242050.1 |
| Coordinates | 3763975..3764385 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | OM419_RS17585 | Protein ID | WP_006178375.1 |
| Coordinates | 3764366..3764632 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM419_RS17560 (OM419_17555) | 3759968..3761701 | - | 1734 | WP_277737904.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OM419_RS17565 (OM419_17560) | 3761707..3762420 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OM419_RS17570 (OM419_17565) | 3762449..3763345 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
| OM419_RS17575 (OM419_17570) | 3763447..3763968 | + | 522 | WP_277737905.1 | flavodoxin FldB | - |
| OM419_RS17580 (OM419_17575) | 3763975..3764385 | - | 411 | WP_021242050.1 | protein YgfX | Toxin |
| OM419_RS17585 (OM419_17580) | 3764366..3764632 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| OM419_RS17590 (OM419_17585) | 3764927..3765907 | + | 981 | WP_008499712.1 | tRNA-modifying protein YgfZ | - |
| OM419_RS17595 (OM419_17590) | 3765992..3766651 | - | 660 | WP_032653297.1 | hemolysin III family protein | - |
| OM419_RS17600 (OM419_17595) | 3766917..3767648 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
| OM419_RS17605 (OM419_17600) | 3767765..3769198 | + | 1434 | WP_277737906.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T264365 WP_021242050.1 NZ_CP110823:c3764385-3763975 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |