Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 3728181..3728880 | Replicon | chromosome |
Accession | NZ_CP110823 | ||
Organism | Enterobacter roggenkampii strain WS22-2 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | OM419_RS17375 | Protein ID | WP_090392716.1 |
Coordinates | 3728181..3728504 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OM419_RS17380 | Protein ID | WP_277737894.1 |
Coordinates | 3728524..3728880 (-) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM419_RS17370 (OM419_17365) | 3725892..3727556 | - | 1665 | WP_277737893.1 | ShlB/FhaC/HecB family hemolysin secretion/activation protein | - |
OM419_RS17375 (OM419_17370) | 3728181..3728504 | - | 324 | WP_090392716.1 | TA system toxin CbtA family protein | Toxin |
OM419_RS17380 (OM419_17375) | 3728524..3728880 | - | 357 | WP_277737894.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OM419_RS17385 (OM419_17380) | 3728906..3729127 | - | 222 | Protein_3398 | DUF987 family protein | - |
OM419_RS17390 (OM419_17385) | 3729124..3729666 | - | 543 | WP_277737895.1 | DNA repair protein RadC | - |
OM419_RS17395 (OM419_17390) | 3729679..3730128 | - | 450 | WP_277737896.1 | antirestriction protein | - |
OM419_RS17400 (OM419_17395) | 3730159..3730980 | - | 822 | WP_277737897.1 | DUF932 domain-containing protein | - |
OM419_RS17405 (OM419_17400) | 3731083..3731316 | - | 234 | WP_277718033.1 | DUF905 domain-containing protein | - |
OM419_RS17410 (OM419_17405) | 3731410..3732246 | - | 837 | WP_277718034.1 | hypothetical protein | - |
OM419_RS17415 (OM419_17410) | 3732304..3732549 | - | 246 | WP_277718035.1 | hypothetical protein | - |
OM419_RS17420 (OM419_17415) | 3732549..3732776 | - | 228 | WP_277718036.1 | hypothetical protein | - |
OM419_RS17425 (OM419_17420) | 3732849..3733256 | - | 408 | WP_211778063.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimA / fimC / fimD / fimF / fimG | 3728181..3755439 | 27258 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12313.16 Da Isoelectric Point: 6.2134
>T264364 WP_090392716.1 NZ_CP110823:c3728504-3728181 [Enterobacter roggenkampii]
MKYQPATTLWAAKPSLSPVAVWQMLLTRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAVNFLVEKYELARIDHRGF
GWNEQTPYLTIVDIMRARRDLGLLNRN
MKYQPATTLWAAKPSLSPVAVWQMLLTRLLEQHYGLTLNDTPFCDETVIQEHIDAGITLANAVNFLVEKYELARIDHRGF
GWNEQTPYLTIVDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13128.73 Da Isoelectric Point: 5.4242
>AT264364 WP_277737894.1 NZ_CP110823:c3728880-3728524 [Enterobacter roggenkampii]
MNNHSESGTGPENPACQQWGLKSTITPYFGARLVQEGYRVHFLADRAGFTGALSEDDALHLDQVFPLILKQLELMFTSGE
LSSRHQHCVTLYHNGLTCEADTLGSCGYIYIAIYPTQY
MNNHSESGTGPENPACQQWGLKSTITPYFGARLVQEGYRVHFLADRAGFTGALSEDDALHLDQVFPLILKQLELMFTSGE
LSSRHQHCVTLYHNGLTCEADTLGSCGYIYIAIYPTQY
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|