Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 1665738..1666535 | Replicon | chromosome |
| Accession | NZ_CP110823 | ||
| Organism | Enterobacter roggenkampii strain WS22-2 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | OM419_RS07795 | Protein ID | WP_277738336.1 |
| Coordinates | 1666014..1666535 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | W7PG43 |
| Locus tag | OM419_RS07790 | Protein ID | WP_008499829.1 |
| Coordinates | 1665738..1666007 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM419_RS07760 (OM419_07755) | 1661361..1661804 | - | 444 | WP_008499834.1 | helix-turn-helix domain-containing protein | - |
| OM419_RS07765 (OM419_07760) | 1661957..1663198 | + | 1242 | WP_277738335.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
| OM419_RS07770 (OM419_07765) | 1663234..1663461 | - | 228 | WP_008499832.1 | YccJ family protein | - |
| OM419_RS07775 (OM419_07770) | 1663482..1664078 | - | 597 | WP_008499831.1 | NAD(P)H:quinone oxidoreductase | - |
| OM419_RS07780 (OM419_07775) | 1664470..1664640 | + | 171 | WP_013097201.1 | general stress protein | - |
| OM419_RS07785 (OM419_07780) | 1664759..1665676 | + | 918 | WP_023292825.1 | DMT family transporter | - |
| OM419_RS07790 (OM419_07785) | 1665738..1666007 | + | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
| OM419_RS07795 (OM419_07790) | 1666014..1666535 | + | 522 | WP_277738336.1 | N-acetyltransferase | Toxin |
| OM419_RS07800 (OM419_07795) | 1666609..1667931 | - | 1323 | WP_277738337.1 | pyrimidine utilization transport protein G | - |
| OM419_RS07805 (OM419_07800) | 1667953..1668447 | - | 495 | WP_123922610.1 | pyrimidine utilization flavin reductase protein F | - |
| OM419_RS07810 (OM419_07805) | 1668457..1669047 | - | 591 | WP_023327079.1 | malonic semialdehyde reductase | - |
| OM419_RS07815 (OM419_07810) | 1669057..1669857 | - | 801 | WP_277738338.1 | pyrimidine utilization protein D | - |
| OM419_RS07820 (OM419_07815) | 1669865..1670251 | - | 387 | WP_008499822.1 | pyrimidine utilization protein C | - |
| OM419_RS07825 (OM419_07820) | 1670263..1670952 | - | 690 | WP_047745127.1 | pyrimidine utilization protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19703.44 Da Isoelectric Point: 7.4313
>T264359 WP_277738336.1 NZ_CP110823:1666014-1666535 [Enterobacter roggenkampii]
VDNLTIEMFSEGKDYNFRDFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNDQAKQFYLKQGFISLTDENSHSLF
FPTKSIERLFEQA
VDNLTIEMFSEGKDYNFRDFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAIHKDLQGLEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNDQAKQFYLKQGFISLTDENSHSLF
FPTKSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|