Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1037045..1037665 | Replicon | chromosome |
Accession | NZ_CP110823 | ||
Organism | Enterobacter roggenkampii strain WS22-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | OM419_RS04805 | Protein ID | WP_008499287.1 |
Coordinates | 1037045..1037263 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | OM419_RS04810 | Protein ID | WP_008499288.1 |
Coordinates | 1037291..1037665 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM419_RS04775 (OM419_04775) | 1033058..1033318 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
OM419_RS04780 (OM419_04780) | 1033321..1033461 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
OM419_RS04785 (OM419_04785) | 1033458..1034168 | - | 711 | WP_277738229.1 | GNAT family protein | - |
OM419_RS04790 (OM419_04790) | 1034270..1035730 | + | 1461 | WP_277738230.1 | PLP-dependent aminotransferase family protein | - |
OM419_RS04795 (OM419_04795) | 1035702..1036169 | - | 468 | WP_008499285.1 | YlaC family protein | - |
OM419_RS04800 (OM419_04800) | 1036287..1036838 | - | 552 | WP_008499286.1 | maltose O-acetyltransferase | - |
OM419_RS04805 (OM419_04805) | 1037045..1037263 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
OM419_RS04810 (OM419_04810) | 1037291..1037665 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
OM419_RS04815 (OM419_04815) | 1038175..1041321 | - | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OM419_RS04820 (OM419_04820) | 1041344..1042537 | - | 1194 | WP_232927929.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T264358 WP_008499287.1 NZ_CP110823:c1037263-1037045 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT264358 WP_008499288.1 NZ_CP110823:c1037665-1037291 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |