Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 581875..582451 | Replicon | chromosome |
| Accession | NZ_CP110823 | ||
| Organism | Enterobacter roggenkampii strain WS22-2 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A656ULU9 |
| Locus tag | OM419_RS02680 | Protein ID | WP_025912099.1 |
| Coordinates | 581875..582162 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A7D6YIG8 |
| Locus tag | OM419_RS02685 | Protein ID | WP_025912101.1 |
| Coordinates | 582149..582451 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM419_RS02650 (OM419_02650) | 576888..577004 | + | 117 | Protein_511 | amino acid-binding protein | - |
| OM419_RS02655 (OM419_02655) | 576997..577692 | + | 696 | WP_039023948.1 | winged helix-turn-helix domain-containing protein | - |
| OM419_RS02660 (OM419_02660) | 577838..578308 | + | 471 | WP_126324966.1 | MarR family transcriptional regulator | - |
| OM419_RS02665 (OM419_02665) | 578305..579372 | + | 1068 | WP_277738499.1 | HlyD family secretion protein | - |
| OM419_RS02670 (OM419_02670) | 579362..580438 | + | 1077 | WP_094943938.1 | DUF2955 domain-containing protein | - |
| OM419_RS02675 (OM419_02675) | 580435..581706 | - | 1272 | WP_087450691.1 | DUF445 domain-containing protein | - |
| OM419_RS02680 (OM419_02680) | 581875..582162 | + | 288 | WP_025912099.1 | BrnT family toxin | Toxin |
| OM419_RS02685 (OM419_02685) | 582149..582451 | + | 303 | WP_025912101.1 | BrnA antitoxin family protein | Antitoxin |
| OM419_RS02690 (OM419_02690) | 582482..583120 | - | 639 | WP_277738147.1 | LysE family translocator | - |
| OM419_RS02695 (OM419_02695) | 583168..583911 | - | 744 | WP_059363112.1 | AraC family transcriptional regulator | - |
| OM419_RS02700 (OM419_02700) | 584063..585433 | + | 1371 | WP_059363111.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| OM419_RS02705 (OM419_02705) | 585479..585799 | - | 321 | WP_032660910.1 | hypothetical protein | - |
| OM419_RS02710 (OM419_02710) | 585799..586344 | - | 546 | WP_008501313.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11235.68 Da Isoelectric Point: 7.4007
>T264357 WP_025912099.1 NZ_CP110823:581875-582162 [Enterobacter roggenkampii]
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPTEYEWDSNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGEFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ULU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D6YIG8 |