Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 44118..44779 | Replicon | chromosome |
Accession | NZ_CP110823 | ||
Organism | Enterobacter roggenkampii strain WS22-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OM419_RS00220 | Protein ID | WP_023293716.1 |
Coordinates | 44381..44779 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A156KC23 |
Locus tag | OM419_RS00215 | Protein ID | WP_032675702.1 |
Coordinates | 44118..44384 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM419_RS00190 (OM419_00190) | 40171..41499 | - | 1329 | WP_023326395.1 | PTS sugar transporter subunit IIC | - |
OM419_RS00195 (OM419_00195) | 41511..41825 | - | 315 | WP_087450466.1 | PTS sugar transporter subunit IIB | - |
OM419_RS00200 (OM419_00200) | 42119..43069 | + | 951 | WP_023293714.1 | LacI family DNA-binding transcriptional regulator | - |
OM419_RS00205 (OM419_00205) | 43131..43427 | - | 297 | WP_021242704.1 | YicS family protein | - |
OM419_RS00210 (OM419_00210) | 43569..43988 | + | 420 | WP_008500129.1 | GNAT family N-acetyltransferase | - |
OM419_RS00215 (OM419_00215) | 44118..44384 | + | 267 | WP_032675702.1 | virulence protein | Antitoxin |
OM419_RS00220 (OM419_00220) | 44381..44779 | + | 399 | WP_023293716.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OM419_RS00225 (OM419_00225) | 44919..45719 | + | 801 | WP_277738043.1 | lipoprotein NlpA | - |
OM419_RS00230 (OM419_00230) | 45842..46621 | + | 780 | WP_277738044.1 | MBL fold metallo-hydrolase | - |
OM419_RS00235 (OM419_00235) | 46648..47601 | + | 954 | WP_055321086.1 | helix-turn-helix domain-containing protein | - |
OM419_RS00240 (OM419_00240) | 47784..49481 | + | 1698 | WP_277738540.1 | ShlB/FhaC/HecB family hemolysin secretion/activation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14799.00 Da Isoelectric Point: 6.4779
>T264356 WP_023293716.1 NZ_CP110823:44381-44779 [Enterobacter roggenkampii]
MRHMLDTNIVSHLFKRHPEVVSRMTCLAPGDVCISSITEAELLYGADKKKSSRLKETIREFLNTITICDWDSDAAATYGE
LRATLEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFRMVQELAVEDWTTTL
MRHMLDTNIVSHLFKRHPEVVSRMTCLAPGDVCISSITEAELLYGADKKKSSRLKETIREFLNTITICDWDSDAAATYGE
LRATLEKKGKVMGDLDQLIAAHAISRGTTIVTNDRAFRMVQELAVEDWTTTL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|