Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 63387..64030 | Replicon | plasmid pHB42-F5 |
Accession | NZ_CP110817 | ||
Organism | Escherichia coli strain THB42-F5 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N0566_RS22710 | Protein ID | WP_001044768.1 |
Coordinates | 63387..63803 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N0566_RS22715 | Protein ID | WP_001261287.1 |
Coordinates | 63800..64030 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0566_RS22695 (59886) | 59886..60476 | - | 591 | WP_000194575.1 | hypothetical protein | - |
N0566_RS22700 (60476) | 60476..60733 | - | 258 | WP_000343085.1 | hypothetical protein | - |
N0566_RS22705 (61087) | 61087..63225 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
N0566_RS22710 (63387) | 63387..63803 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0566_RS22715 (63800) | 63800..64030 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0566_RS22720 (64326) | 64326..64616 | + | 291 | WP_000111771.1 | hypothetical protein | - |
N0566_RS22725 (64606) | 64606..65505 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
N0566_RS22730 (65555) | 65555..67780 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
N0566_RS22735 (67782) | 67782..68870 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aph(3')-IIa / dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / blaCTX-M-55 | - | 1..161920 | 161920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T264352 WP_001044768.1 NZ_CP110817:c63803-63387 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |