Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3950807..3951621 | Replicon | chromosome |
Accession | NZ_CP110816 | ||
Organism | Escherichia coli strain THB42-F5 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | N0566_RS19280 | Protein ID | WP_001054376.1 |
Coordinates | 3950807..3951064 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | N0566_RS19285 | Protein ID | WP_001309181.1 |
Coordinates | 3951076..3951621 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0566_RS19255 (3946095) | 3946095..3947201 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
N0566_RS19260 (3947266) | 3947266..3948246 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
N0566_RS19265 (3948356) | 3948356..3948561 | + | 206 | Protein_3761 | HNH endonuclease | - |
N0566_RS19270 (3948829) | 3948829..3950069 | - | 1241 | Protein_3762 | helicase YjhR | - |
N0566_RS19275 (3950185) | 3950185..3950316 | + | 132 | WP_001309182.1 | hypothetical protein | - |
N0566_RS19280 (3950807) | 3950807..3951064 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
N0566_RS19285 (3951076) | 3951076..3951621 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
N0566_RS19290 (3951677) | 3951677..3952423 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
N0566_RS19295 (3952592) | 3952592..3952810 | + | 219 | Protein_3767 | hypothetical protein | - |
N0566_RS19300 (3952848) | 3952848..3952964 | + | 117 | Protein_3768 | VOC family protein | - |
N0566_RS19305 (3953209) | 3953209..3954330 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
N0566_RS19310 (3954327) | 3954327..3954605 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
N0566_RS19315 (3954617) | 3954617..3955930 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 3939817..3959845 | 20028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T264347 WP_001054376.1 NZ_CP110816:3950807-3951064 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT264347 WP_001309181.1 NZ_CP110816:3951076-3951621 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|