Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 974429..975012 | Replicon | chromosome |
Accession | NZ_CP110816 | ||
Organism | Escherichia coli strain THB42-F5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N0566_RS04670 | Protein ID | WP_000254738.1 |
Coordinates | 974677..975012 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N0566_RS04665 | Protein ID | WP_000581937.1 |
Coordinates | 974429..974677 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0566_RS04655 (970768) | 970768..972069 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N0566_RS04660 (972117) | 972117..974351 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N0566_RS04665 (974429) | 974429..974677 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N0566_RS04670 (974677) | 974677..975012 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N0566_RS04675 (975083) | 975083..975874 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N0566_RS04680 (976102) | 976102..977739 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N0566_RS04685 (977827) | 977827..979125 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T264329 WP_000254738.1 NZ_CP110816:974677-975012 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|