Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 66544..67187 | Replicon | plasmid pHB42-F4 |
| Accession | NZ_CP110815 | ||
| Organism | Escherichia coli strain THB42-F4 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | N0552_RS22720 | Protein ID | WP_001044768.1 |
| Coordinates | 66544..66960 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | N0552_RS22725 | Protein ID | WP_001261287.1 |
| Coordinates | 66957..67187 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0552_RS22695 (62293) | 62293..62478 | - | 186 | WP_265639458.1 | hypothetical protein | - |
| N0552_RS22700 (62505) | 62505..62780 | - | 276 | WP_265639459.1 | AAA family ATPase | - |
| N0552_RS22705 (63043) | 63043..63633 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| N0552_RS22710 (63633) | 63633..63890 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| N0552_RS22715 (64244) | 64244..66382 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| N0552_RS22720 (66544) | 66544..66960 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0552_RS22725 (66957) | 66957..67187 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N0552_RS22730 (67483) | 67483..67773 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| N0552_RS22735 (67763) | 67763..68662 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| N0552_RS22740 (68712) | 68712..70937 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| N0552_RS22745 (70939) | 70939..72027 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55 | - | 1..162755 | 162755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T264320 WP_001044768.1 NZ_CP110815:c66960-66544 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |