Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 66544..67187 Replicon plasmid pHB42-F4
Accession NZ_CP110815
Organism Escherichia coli strain THB42-F4

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag N0552_RS22720 Protein ID WP_001044768.1
Coordinates 66544..66960 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag N0552_RS22725 Protein ID WP_001261287.1
Coordinates 66957..67187 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0552_RS22695 (62293) 62293..62478 - 186 WP_265639458.1 hypothetical protein -
N0552_RS22700 (62505) 62505..62780 - 276 WP_265639459.1 AAA family ATPase -
N0552_RS22705 (63043) 63043..63633 - 591 WP_000194575.1 hypothetical protein -
N0552_RS22710 (63633) 63633..63890 - 258 WP_000343085.1 hypothetical protein -
N0552_RS22715 (64244) 64244..66382 + 2139 WP_000350638.1 AAA family ATPase -
N0552_RS22720 (66544) 66544..66960 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
N0552_RS22725 (66957) 66957..67187 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N0552_RS22730 (67483) 67483..67773 + 291 WP_000111771.1 hypothetical protein -
N0552_RS22735 (67763) 67763..68662 + 900 WP_000963206.1 nucleotide-binding protein -
N0552_RS22740 (68712) 68712..70937 - 2226 WP_000698737.1 P-loop NTPase fold protein -
N0552_RS22745 (70939) 70939..72027 - 1089 WP_000952217.1 transcriptional repressor PifC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / rmtB / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-55 - 1..162755 162755


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T264320 WP_001044768.1 NZ_CP110815:c66960-66544 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT264320 WP_001261287.1 NZ_CP110815:c67187-66957 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References