Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 3950918..3951732 | Replicon | chromosome |
| Accession | NZ_CP110814 | ||
| Organism | Escherichia coli strain THB42-F4 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | N0552_RS19270 | Protein ID | WP_001054376.1 |
| Coordinates | 3950918..3951175 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | N0552_RS19275 | Protein ID | WP_001309181.1 |
| Coordinates | 3951187..3951732 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0552_RS19245 (3946206) | 3946206..3947312 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| N0552_RS19250 (3947377) | 3947377..3948357 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| N0552_RS19255 (3948467) | 3948467..3948672 | + | 206 | Protein_3760 | HNH endonuclease | - |
| N0552_RS19260 (3948940) | 3948940..3950180 | - | 1241 | Protein_3761 | helicase YjhR | - |
| N0552_RS19265 (3950296) | 3950296..3950427 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| N0552_RS19270 (3950918) | 3950918..3951175 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| N0552_RS19275 (3951187) | 3951187..3951732 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| N0552_RS19280 (3951788) | 3951788..3952534 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| N0552_RS19285 (3952703) | 3952703..3952921 | + | 219 | Protein_3766 | hypothetical protein | - |
| N0552_RS19290 (3952959) | 3952959..3953075 | + | 117 | Protein_3767 | VOC family protein | - |
| N0552_RS19295 (3953320) | 3953320..3954441 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| N0552_RS19300 (3954438) | 3954438..3954716 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| N0552_RS19305 (3954728) | 3954728..3956041 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 3939928..3959956 | 20028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T264315 WP_001054376.1 NZ_CP110814:3950918-3951175 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT264315 WP_001309181.1 NZ_CP110814:3951187-3951732 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|