Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3523500..3524179 | Replicon | chromosome |
Accession | NZ_CP110814 | ||
Organism | Escherichia coli strain THB42-F4 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | N0552_RS17175 | Protein ID | WP_000854672.1 |
Coordinates | 3523500..3523841 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | N0552_RS17180 | Protein ID | WP_000070395.1 |
Coordinates | 3523862..3524179 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0552_RS17150 (3519086) | 3519086..3519178 | + | 93 | Protein_3350 | sigma factor-binding protein Crl | - |
N0552_RS17155 (3519217) | 3519217..3520272 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
N0552_RS17160 (3520560) | 3520560..3521663 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
N0552_RS17165 (3521675) | 3521675..3522928 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
N0552_RS17175 (3523500) | 3523500..3523841 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
N0552_RS17180 (3523862) | 3523862..3524179 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
N0552_RS17185 (3524198) | 3524198..3524419 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
N0552_RS17190 (3524428) | 3524428..3524904 | - | 477 | WP_000811693.1 | RadC family protein | - |
N0552_RS17195 (3524920) | 3524920..3525378 | - | 459 | WP_000211838.1 | antirestriction protein | - |
N0552_RS17200 (3525476) | 3525476..3525715 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
N0552_RS17205 (3525792) | 3525792..3526259 | - | 468 | WP_001547765.1 | protein YkfB | - |
N0552_RS17210 (3526282) | 3526282..3526725 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
N0552_RS17215 (3526725) | 3526725..3526901 | - | 177 | WP_001285112.1 | hypothetical protein | - |
N0552_RS17220 (3526948) | 3526948..3527139 | - | 192 | Protein_3363 | DeoR family transcriptional regulator | - |
N0552_RS17225 (3527356) | 3527356..3528177 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
N0552_RS17230 (3528269) | 3528269..3529132 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T264310 WP_000854672.1 NZ_CP110814:c3523841-3523500 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|