Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3399821..3400439 | Replicon | chromosome |
Accession | NZ_CP110814 | ||
Organism | Escherichia coli strain THB42-F4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N0552_RS16565 | Protein ID | WP_001291435.1 |
Coordinates | 3400221..3400439 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N0552_RS16560 | Protein ID | WP_000344800.1 |
Coordinates | 3399821..3400195 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0552_RS16550 (3394910) | 3394910..3396103 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N0552_RS16555 (3396126) | 3396126..3399275 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N0552_RS16560 (3399821) | 3399821..3400195 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N0552_RS16565 (3400221) | 3400221..3400439 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N0552_RS16570 (3400611) | 3400611..3401162 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N0552_RS16575 (3401278) | 3401278..3401748 | + | 471 | WP_001716237.1 | YlaC family protein | - |
N0552_RS16580 (3401912) | 3401912..3403462 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N0552_RS16585 (3403504) | 3403504..3403857 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N0552_RS16595 (3404236) | 3404236..3404547 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N0552_RS16600 (3404578) | 3404578..3405150 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264309 WP_001291435.1 NZ_CP110814:3400221-3400439 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT264309 WP_000344800.1 NZ_CP110814:3399821-3400195 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |