Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2221603..2222239 Replicon chromosome
Accession NZ_CP110812
Organism Bacillus paralicheniformis strain CamBx3

Toxin (Protein)


Gene name mazF Uniprot ID M5P3Q9
Locus tag OPU65_RS11545 Protein ID WP_003179128.1
Coordinates 2221603..2221953 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID M5PDU2
Locus tag OPU65_RS11550 Protein ID WP_006638778.1
Coordinates 2221958..2222239 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPU65_RS11505 (OPU65_11505) 2216647..2217246 - 600 WP_165426110.1 PP2C family serine/threonine-protein phosphatase -
OPU65_RS11510 (OPU65_11510) 2217243..2218034 - 792 WP_023857858.1 RNA polymerase sigma factor SigB -
OPU65_RS11515 (OPU65_11515) 2218000..2218482 - 483 WP_165426109.1 anti-sigma B factor RsbW -
OPU65_RS11520 (OPU65_11520) 2218482..2218808 - 327 WP_243944265.1 anti-sigma factor antagonist -
OPU65_RS11525 (OPU65_11525) 2218867..2219874 - 1008 WP_265627783.1 PP2C family protein-serine/threonine phosphatase -
OPU65_RS11530 (OPU65_11530) 2219885..2220286 - 402 WP_009330126.1 anti-sigma regulatory factor -
OPU65_RS11535 (OPU65_11535) 2220289..2220654 - 366 WP_243944263.1 STAS domain-containing protein -
OPU65_RS11540 (OPU65_11540) 2220658..2221485 - 828 WP_243944262.1 RsbT co-antagonist protein RsbRA -
OPU65_RS11545 (OPU65_11545) 2221603..2221953 - 351 WP_003179128.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
OPU65_RS11550 (OPU65_11550) 2221958..2222239 - 282 WP_006638778.1 hypothetical protein Antitoxin
OPU65_RS11555 (OPU65_11555) 2222351..2223520 - 1170 WP_265627784.1 alanine racemase -
OPU65_RS11560 (OPU65_11560) 2223824..2224306 - 483 WP_165428596.1 IS200/IS605 family transposase -
OPU65_RS11565 (OPU65_11565) 2224494..2225453 - 960 WP_165395380.1 outer membrane lipoprotein carrier protein LolA -
OPU65_RS11570 (OPU65_11570) 2225797..2226396 + 600 WP_265627785.1 rhomboid family intramembrane serine protease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2223824..2224306 482


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12990.03 Da        Isoelectric Point: 5.7234

>T264291 WP_003179128.1 NZ_CP110812:c2221953-2221603 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10649.03 Da        Isoelectric Point: 4.6920

>AT264291 WP_006638778.1 NZ_CP110812:c2222239-2221958 [Bacillus paralicheniformis]
MSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKMYLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEY
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6I7FHI4

Antitoxin

Source ID Structure
AlphaFold DB M5PDU2

References