Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2221603..2222239 | Replicon | chromosome |
| Accession | NZ_CP110812 | ||
| Organism | Bacillus paralicheniformis strain CamBx3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | OPU65_RS11545 | Protein ID | WP_003179128.1 |
| Coordinates | 2221603..2221953 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | OPU65_RS11550 | Protein ID | WP_006638778.1 |
| Coordinates | 2221958..2222239 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPU65_RS11505 (OPU65_11505) | 2216647..2217246 | - | 600 | WP_165426110.1 | PP2C family serine/threonine-protein phosphatase | - |
| OPU65_RS11510 (OPU65_11510) | 2217243..2218034 | - | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
| OPU65_RS11515 (OPU65_11515) | 2218000..2218482 | - | 483 | WP_165426109.1 | anti-sigma B factor RsbW | - |
| OPU65_RS11520 (OPU65_11520) | 2218482..2218808 | - | 327 | WP_243944265.1 | anti-sigma factor antagonist | - |
| OPU65_RS11525 (OPU65_11525) | 2218867..2219874 | - | 1008 | WP_265627783.1 | PP2C family protein-serine/threonine phosphatase | - |
| OPU65_RS11530 (OPU65_11530) | 2219885..2220286 | - | 402 | WP_009330126.1 | anti-sigma regulatory factor | - |
| OPU65_RS11535 (OPU65_11535) | 2220289..2220654 | - | 366 | WP_243944263.1 | STAS domain-containing protein | - |
| OPU65_RS11540 (OPU65_11540) | 2220658..2221485 | - | 828 | WP_243944262.1 | RsbT co-antagonist protein RsbRA | - |
| OPU65_RS11545 (OPU65_11545) | 2221603..2221953 | - | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OPU65_RS11550 (OPU65_11550) | 2221958..2222239 | - | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| OPU65_RS11555 (OPU65_11555) | 2222351..2223520 | - | 1170 | WP_265627784.1 | alanine racemase | - |
| OPU65_RS11560 (OPU65_11560) | 2223824..2224306 | - | 483 | WP_165428596.1 | IS200/IS605 family transposase | - |
| OPU65_RS11565 (OPU65_11565) | 2224494..2225453 | - | 960 | WP_165395380.1 | outer membrane lipoprotein carrier protein LolA | - |
| OPU65_RS11570 (OPU65_11570) | 2225797..2226396 | + | 600 | WP_265627785.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2223824..2224306 | 482 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T264291 WP_003179128.1 NZ_CP110812:c2221953-2221603 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |