Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 21611..22158 Replicon plasmid pMUP32b
Accession NZ_CP110811
Organism Pseudomonas syringae strain MUP32

Toxin (Protein)


Gene name mazF Uniprot ID Q48B48
Locus tag OQB64_RS26750 Protein ID WP_003319696.1
Coordinates 21611..21937 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A7V8M172
Locus tag OQB64_RS26755 Protein ID WP_003319697.1
Coordinates 21934..22158 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQB64_RS26730 (OQB64_26730) 20177..20449 - 273 WP_003348606.1 type II toxin-antitoxin system RelE/ParE family toxin -
OQB64_RS26735 (OQB64_26735) 20439..20624 - 186 WP_005730485.1 hypothetical protein -
OQB64_RS26740 (OQB64_26740) 20675..20953 - 279 WP_003320513.1 hypothetical protein -
OQB64_RS26745 (OQB64_26745) 21046..21177 - 132 Protein_25 resolvase -
OQB64_RS26750 (OQB64_26750) 21611..21937 - 327 WP_003319696.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OQB64_RS26755 (OQB64_26755) 21934..22158 - 225 WP_003319697.1 antitoxin MazE family protein Antitoxin
OQB64_RS26760 (OQB64_26760) 22648..23280 + 633 WP_003381804.1 ParA family protein -
OQB64_RS26765 (OQB64_26765) 23316..23570 + 255 WP_003381801.1 hypothetical protein -
OQB64_RS26770 (OQB64_26770) 23995..24660 - 666 WP_024647998.1 LexA family transcriptional regulator -
OQB64_RS26775 (OQB64_26775) 24748..24978 + 231 WP_010215521.1 Cro/CI family transcriptional regulator -
OQB64_RS26780 (OQB64_26780) 25330..26028 + 699 WP_024650160.1 lytic transglycosylase domain-containing protein -
OQB64_RS26785 (OQB64_26785) 26025..26363 + 339 WP_003347417.1 hypothetical protein -
OQB64_RS26790 (OQB64_26790) 26376..26651 + 276 WP_024650162.1 VirB3 family type IV secretion system protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..54993 54993


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-103)

Antitoxin

Antitoxin MazE-like

(8-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11660.71 Da        Isoelectric Point: 8.0546

>T264289 WP_003319696.1 NZ_CP110811:c21937-21611 [Pseudomonas syringae]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8471.61 Da        Isoelectric Point: 6.2008

>AT264289 WP_003319697.1 NZ_CP110811:c22158-21934 [Pseudomonas syringae]
MPTSHVNARVQRHRDALRAAGLRPIQIWVPDTRRPDFAQECHRQCLLVAQADMANTYMQGLMDEALDDVEGWTP

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7V8S2J7

Antitoxin

Source ID Structure
AlphaFold DB A0A7V8M172

References