Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 21611..22158 | Replicon | plasmid pMUP32b |
| Accession | NZ_CP110811 | ||
| Organism | Pseudomonas syringae strain MUP32 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q48B48 |
| Locus tag | OQB64_RS26750 | Protein ID | WP_003319696.1 |
| Coordinates | 21611..21937 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A7V8M172 |
| Locus tag | OQB64_RS26755 | Protein ID | WP_003319697.1 |
| Coordinates | 21934..22158 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQB64_RS26730 (OQB64_26730) | 20177..20449 | - | 273 | WP_003348606.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OQB64_RS26735 (OQB64_26735) | 20439..20624 | - | 186 | WP_005730485.1 | hypothetical protein | - |
| OQB64_RS26740 (OQB64_26740) | 20675..20953 | - | 279 | WP_003320513.1 | hypothetical protein | - |
| OQB64_RS26745 (OQB64_26745) | 21046..21177 | - | 132 | Protein_25 | resolvase | - |
| OQB64_RS26750 (OQB64_26750) | 21611..21937 | - | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OQB64_RS26755 (OQB64_26755) | 21934..22158 | - | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
| OQB64_RS26760 (OQB64_26760) | 22648..23280 | + | 633 | WP_003381804.1 | ParA family protein | - |
| OQB64_RS26765 (OQB64_26765) | 23316..23570 | + | 255 | WP_003381801.1 | hypothetical protein | - |
| OQB64_RS26770 (OQB64_26770) | 23995..24660 | - | 666 | WP_024647998.1 | LexA family transcriptional regulator | - |
| OQB64_RS26775 (OQB64_26775) | 24748..24978 | + | 231 | WP_010215521.1 | Cro/CI family transcriptional regulator | - |
| OQB64_RS26780 (OQB64_26780) | 25330..26028 | + | 699 | WP_024650160.1 | lytic transglycosylase domain-containing protein | - |
| OQB64_RS26785 (OQB64_26785) | 26025..26363 | + | 339 | WP_003347417.1 | hypothetical protein | - |
| OQB64_RS26790 (OQB64_26790) | 26376..26651 | + | 276 | WP_024650162.1 | VirB3 family type IV secretion system protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..54993 | 54993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T264289 WP_003319696.1 NZ_CP110811:c21937-21611 [Pseudomonas syringae]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8S2J7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8M172 |