Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
| Location | 12995..13606 | Replicon | plasmid pMUP32b |
| Accession | NZ_CP110811 | ||
| Organism | Pseudomonas syringae strain MUP32 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A7Z6UVP4 |
| Locus tag | OQB64_RS26720 | Protein ID | WP_003348598.1 |
| Coordinates | 13256..13606 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | Q48B86 |
| Locus tag | OQB64_RS26715 | Protein ID | WP_004662018.1 |
| Coordinates | 12995..13243 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQB64_RS26690 (OQB64_26690) | 8549..8836 | + | 288 | WP_003348585.1 | hypothetical protein | - |
| OQB64_RS26695 (OQB64_26695) | 9048..9689 | + | 642 | WP_110768561.1 | SOS response-associated peptidase | - |
| OQB64_RS26700 (OQB64_26700) | 9877..10452 | + | 576 | WP_003348590.1 | PBECR2 nuclease fold domain-containing protein | - |
| OQB64_RS26705 (OQB64_26705) | 11390..12364 | - | 975 | WP_080271137.1 | tyrosine-type recombinase/integrase | - |
| OQB64_RS26710 (OQB64_26710) | 12393..12755 | - | 363 | WP_124733765.1 | hypothetical protein | - |
| OQB64_RS26715 (OQB64_26715) | 12995..13243 | + | 249 | WP_004662018.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| OQB64_RS26720 (OQB64_26720) | 13256..13606 | + | 351 | WP_003348598.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..54993 | 54993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12994.80 Da Isoelectric Point: 4.1953
>T264287 WP_003348598.1 NZ_CP110811:13256-13606 [Pseudomonas syringae]
MNTFALRFTEVAQQSLEDQVEHLAVYQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGINDIAVLLVLGGKQSVEQALIRYCLLQPM
MNTFALRFTEVAQQSLEDQVEHLAVYQGFSSAAQRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGINDIAVLLVLGGKQSVEQALIRYCLLQPM
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z6UVP4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N8T3U9 |