Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/-
Location 2269..2747 Replicon plasmid pMUP32b
Accession NZ_CP110811
Organism Pseudomonas syringae strain MUP32

Toxin (Protein)


Gene name relE Uniprot ID H1ZX33
Locus tag OQB64_RS26635 Protein ID WP_003348565.1
Coordinates 2454..2747 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2S4HLF9
Locus tag OQB64_RS26630 Protein ID WP_003348562.1
Coordinates 2269..2454 (+) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQB64_RS26620 (OQB64_26620) 350..1663 + 1314 WP_032495804.1 replication initiation protein -
OQB64_RS26625 (OQB64_26625) 1889..2182 + 294 WP_003348560.1 HU family DNA-binding protein -
OQB64_RS26630 (OQB64_26630) 2269..2454 + 186 WP_003348562.1 hypothetical protein Antitoxin
OQB64_RS26635 (OQB64_26635) 2454..2747 + 294 WP_003348565.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OQB64_RS26640 (OQB64_26640) 2887..3414 + 528 WP_003348567.1 hypothetical protein -
OQB64_RS26645 (OQB64_26645) 3411..3863 - 453 WP_227443078.1 MobA/MobL family protein -
OQB64_RS26650 (OQB64_26650) 3753..3980 + 228 WP_227443077.1 S24 family peptidase -
OQB64_RS26655 (OQB64_26655) 3958..4221 + 264 WP_080270888.1 DNA-directed DNA polymerase -
OQB64_RS26660 (OQB64_26660) 4435..4848 - 414 WP_003348573.1 DUF3757 domain-containing protein -
OQB64_RS26665 (OQB64_26665) 5273..6313 + 1041 WP_080270889.1 DUF4113 domain-containing protein -
OQB64_RS26670 (OQB64_26670) 6467..6754 + 288 WP_074454502.1 hypothetical protein -
OQB64_RS26675 (OQB64_26675) 6848..7258 + 411 WP_005782529.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..54993 54993


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11136.84 Da        Isoelectric Point: 6.2150

>T264286 WP_003348565.1 NZ_CP110811:2454-2747 [Pseudomonas syringae]
MLPIFWLESADNDLAAIIEYIGSRDIAAAERLWQRLRGIVLPLSEHPYLYAISDRVPGMREIVAHPNYLVFYRVTSTRIE
VVNVVHARQEYPQTGLA

Download         Length: 294 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7134.04 Da        Isoelectric Point: 6.4675

>AT264286 WP_003348562.1 NZ_CP110811:2269-2454 [Pseudomonas syringae]
MIDRSPIVSEFETEELEANYTAWLRAKVEASLADSRPAIPHDEVERRMAERLARLRHRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SFZ9

Antitoxin

Source ID Structure
AlphaFold DB A0A2S4HLF9

References