Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 10460..11040 Replicon plasmid pMUP32a
Accession NZ_CP110810
Organism Pseudomonas syringae strain MUP32

Toxin (Protein)


Gene name PumA Uniprot ID Q48B35
Locus tag OQB64_RS26350 Protein ID WP_011282511.1
Coordinates 10741..11040 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag OQB64_RS26345 Protein ID WP_003348777.1
Coordinates 10460..10744 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQB64_RS26320 (OQB64_26320) 5730..6560 - 831 WP_005770909.1 type III effector -
OQB64_RS26325 (OQB64_26325) 6707..7747 + 1041 WP_080270893.1 Y-family DNA polymerase -
OQB64_RS26330 (OQB64_26330) 7948..8142 + 195 WP_054096784.1 hypothetical protein -
OQB64_RS26335 (OQB64_26335) 8824..10032 - 1209 WP_266008268.1 IS91 family transposase -
OQB64_RS26340 (OQB64_26340) 10034..10315 - 282 WP_024647929.1 hypothetical protein -
OQB64_RS26345 (OQB64_26345) 10460..10744 - 285 WP_003348777.1 putative addiction module antidote protein Antitoxin
OQB64_RS26350 (OQB64_26350) 10741..11040 - 300 WP_011282511.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OQB64_RS26355 (OQB64_26355) 11212..11499 + 288 WP_041924941.1 hypothetical protein -
OQB64_RS26360 (OQB64_26360) 11551..11967 + 417 WP_003348781.1 hypothetical protein -
OQB64_RS26365 (OQB64_26365) 12362..13015 + 654 WP_003348786.1 AAA family ATPase -
OQB64_RS26370 (OQB64_26370) 13104..13355 + 252 WP_003348789.1 ribbon-helix-helix protein, CopG family -
OQB64_RS26375 (OQB64_26375) 13623..14264 + 642 WP_058398749.1 SOS response-associated peptidase -
OQB64_RS26380 (OQB64_26380) 14545..15222 + 678 WP_024647926.1 site-specific integrase -
OQB64_RS26385 (OQB64_26385) 15301..15546 + 246 WP_003348793.1 PapB/FocB family fimbrial expression transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..61675 61675
- flank IS/Tn - - 8824..10032 1208


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-96)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11168.79 Da        Isoelectric Point: 10.2231

>T264285 WP_011282511.1 NZ_CP110810:c11040-10741 [Pseudomonas syringae]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKRLADQWRQE

Download         Length: 300 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10263.80 Da        Isoelectric Point: 5.0916

>AT264285 WP_003348777.1 NZ_CP110810:c10744-10460 [Pseudomonas syringae]
MKEQIFDYDPAAALDGPEAIAIFISDAFETGDAEYIAKAMGVVARAKGMSELARETGLSREQLYRSFSSKGNPTLKTMLT
VMRALGVDMTARMH

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M3YY44

Antitoxin

Source ID Structure

References