Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 4354542..4355004 | Replicon | chromosome |
Accession | NZ_CP110809 | ||
Organism | Pseudomonas syringae strain MUP32 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0P9XJI4 |
Locus tag | OQB64_RS19310 | Protein ID | WP_003393317.1 |
Coordinates | 4354723..4355004 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3M2UJ05 |
Locus tag | OQB64_RS19305 | Protein ID | WP_003393315.1 |
Coordinates | 4354542..4354733 (+) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB64_RS19285 (OQB64_19285) | 4350398..4351252 | + | 855 | WP_080270898.1 | XopAF/AvrXv3 family type III secretion system effector | - |
OQB64_RS19290 (OQB64_19290) | 4351256..4351634 | - | 379 | Protein_3794 | transposase | - |
OQB64_RS19295 (OQB64_19295) | 4351897..4353009 | - | 1113 | WP_024647935.1 | hypothetical protein | - |
OQB64_RS19300 (OQB64_19300) | 4353169..4354479 | + | 1311 | WP_124733734.1 | mechanosensitive ion channel family protein | - |
OQB64_RS19305 (OQB64_19305) | 4354542..4354733 | + | 192 | WP_003393315.1 | hypothetical protein | Antitoxin |
OQB64_RS19310 (OQB64_19310) | 4354723..4355004 | + | 282 | WP_003393317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQB64_RS19315 (OQB64_19315) | 4355282..4357402 | + | 2121 | WP_122287600.1 | alpha/beta hydrolase domain-containing protein | - |
OQB64_RS19320 (OQB64_19320) | 4357573..4358613 | + | 1041 | WP_024647852.1 | DUF4062 domain-containing protein | - |
OQB64_RS19325 (OQB64_19325) | 4358966..4359472 | - | 507 | WP_003402417.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4348217..4361506 | 13289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10563.26 Da Isoelectric Point: 9.7428
>T264284 WP_003393317.1 NZ_CP110809:4354723-4355004 [Pseudomonas syringae]
MLVEWRPAARMNLKQILSYIADRNIRAASELGMAIEVATSALPQHPYLYRHGRVHGTREIVVHPNYLVVYKVTDRIEVLA
VLHARQAYPTDAG
MLVEWRPAARMNLKQILSYIADRNIRAASELGMAIEVATSALPQHPYLYRHGRVHGTREIVVHPNYLVVYKVTDRIEVLA
VLHARQAYPTDAG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9XJI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M2UJ05 |