Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4298603..4299226 | Replicon | chromosome |
Accession | NZ_CP110809 | ||
Organism | Pseudomonas syringae strain MUP32 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3M3C685 |
Locus tag | OQB64_RS19015 | Protein ID | WP_003314536.1 |
Coordinates | 4299044..4299226 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A3M3C5W4 |
Locus tag | OQB64_RS19010 | Protein ID | WP_010421644.1 |
Coordinates | 4298603..4299007 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB64_RS18995 (OQB64_18995) | 4294369..4295037 | + | 669 | WP_024648672.1 | ABC transporter ATP-binding protein | - |
OQB64_RS19000 (OQB64_19000) | 4295037..4297517 | + | 2481 | WP_024648671.1 | ABC transporter permease | - |
OQB64_RS19005 (OQB64_19005) | 4297507..4298586 | + | 1080 | WP_024648670.1 | lipocalin-like domain-containing protein | - |
OQB64_RS19010 (OQB64_19010) | 4298603..4299007 | - | 405 | WP_010421644.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OQB64_RS19015 (OQB64_19015) | 4299044..4299226 | - | 183 | WP_003314536.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OQB64_RS19020 (OQB64_19020) | 4299510..4301282 | + | 1773 | WP_004416697.1 | N-acetylglutaminylglutamine amidotransferase | - |
OQB64_RS19025 (OQB64_19025) | 4301286..4303034 | + | 1749 | WP_003418255.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6763.96 Da Isoelectric Point: 10.6643
>T264283 WP_003314536.1 NZ_CP110809:c4299226-4299044 [Pseudomonas syringae]
VQSRQLIKELEADGWVLDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
VQSRQLIKELEADGWVLDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14568.66 Da Isoelectric Point: 5.5960
>AT264283 WP_010421644.1 NZ_CP110809:c4299007-4298603 [Pseudomonas syringae]
MKYPMCIEWGNETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAASGRTIPKAGNVAEHARNPDFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPMCIEWGNETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAASGRTIPKAGNVAEHARNPDFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3C685 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3C5W4 |