Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RHH |
| Location | 2089653..2090166 | Replicon | chromosome |
| Accession | NZ_CP110809 | ||
| Organism | Pseudomonas syringae strain MUP32 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7Z6Y8M4 |
| Locus tag | OQB64_RS09485 | Protein ID | WP_003348947.1 |
| Coordinates | 2089653..2089937 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3M4E5F0 |
| Locus tag | OQB64_RS09490 | Protein ID | WP_024648170.1 |
| Coordinates | 2089927..2090166 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQB64_RS09470 (OQB64_09470) | 2085795..2087723 | + | 1929 | WP_024648167.1 | methyl-accepting chemotaxis protein | - |
| OQB64_RS09475 (OQB64_09475) | 2087757..2088689 | - | 933 | WP_024648168.1 | DMT family transporter | - |
| OQB64_RS09480 (OQB64_09480) | 2088764..2089618 | + | 855 | WP_024648169.1 | LysR family transcriptional regulator | - |
| OQB64_RS09485 (OQB64_09485) | 2089653..2089937 | - | 285 | WP_003348947.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OQB64_RS09490 (OQB64_09490) | 2089927..2090166 | - | 240 | WP_024648170.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OQB64_RS09495 (OQB64_09495) | 2090326..2091342 | - | 1017 | WP_003423368.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
| OQB64_RS09500 (OQB64_09500) | 2091529..2092035 | + | 507 | WP_003315203.1 | Lrp/AsnC family transcriptional regulator | - |
| OQB64_RS09505 (OQB64_09505) | 2092182..2093090 | + | 909 | WP_003423371.1 | DUF808 domain-containing protein | - |
| OQB64_RS09510 (OQB64_09510) | 2093267..2094052 | - | 786 | WP_003423373.1 | outer membrane protein OmpK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10602.32 Da Isoelectric Point: 10.4249
>T264282 WP_003348947.1 NZ_CP110809:c2089937-2089653 [Pseudomonas syringae]
MQVEWLKTALKNLDEEAAYIALDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHARRQSPPVW
MQVEWLKTALKNLDEEAAYIALDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHARRQSPPVW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z6Y8M4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M4E5F0 |