Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1110819..1111453 Replicon chromosome
Accession NZ_CP110809
Organism Pseudomonas syringae strain MUP32

Toxin (Protein)


Gene name vapC Uniprot ID A0A193SM35
Locus tag OQB64_RS05045 Protein ID WP_003345997.1
Coordinates 1110819..1111223 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3M4XXE1
Locus tag OQB64_RS05050 Protein ID WP_003345999.1
Coordinates 1111223..1111453 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQB64_RS05015 (OQB64_05015) 1105839..1106288 - 450 WP_024649228.1 DUF2384 domain-containing protein -
OQB64_RS05020 (OQB64_05020) 1106554..1107558 + 1005 WP_004419200.1 response regulator -
OQB64_RS05025 (OQB64_05025) 1107562..1108044 + 483 WP_024649227.1 PAS domain-containing protein -
OQB64_RS05030 (OQB64_05030) 1108141..1109397 + 1257 WP_004402530.1 3-phosphoshikimate 1-carboxyvinyltransferase -
OQB64_RS05035 (OQB64_05035) 1109420..1110082 - 663 WP_003408532.1 ChrR family anti-sigma-E factor -
OQB64_RS05040 (OQB64_05040) 1110082..1110594 - 513 WP_003345995.1 sigma-70 family RNA polymerase sigma factor -
OQB64_RS05045 (OQB64_05045) 1110819..1111223 - 405 WP_003345997.1 tRNA(fMet)-specific endonuclease VapC Toxin
OQB64_RS05050 (OQB64_05050) 1111223..1111453 - 231 WP_003345999.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OQB64_RS05055 (OQB64_05055) 1111570..1112451 - 882 WP_024649226.1 aldose 1-epimerase -
OQB64_RS05060 (OQB64_05060) 1112426..1113397 - 972 WP_024649225.1 DMT family transporter -
OQB64_RS05065 (OQB64_05065) 1113482..1114762 - 1281 WP_003421655.1 TRAP transporter large permease -
OQB64_RS05070 (OQB64_05070) 1114763..1115290 - 528 WP_024649224.1 TRAP transporter small permease -
OQB64_RS05075 (OQB64_05075) 1115354..1116379 - 1026 WP_024649223.1 TRAP transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14946.21 Da        Isoelectric Point: 6.8620

>T264281 WP_003345997.1 NZ_CP110809:c1111223-1110819 [Pseudomonas syringae]
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARSGTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8580.59 Da        Isoelectric Point: 4.5557

>AT264281 WP_003345999.1 NZ_CP110809:c1111453-1111223 [Pseudomonas syringae]
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAEREQPAEQQRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SM35

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4XXE1

References