Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1110819..1111453 | Replicon | chromosome |
| Accession | NZ_CP110809 | ||
| Organism | Pseudomonas syringae strain MUP32 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A193SM35 |
| Locus tag | OQB64_RS05045 | Protein ID | WP_003345997.1 |
| Coordinates | 1110819..1111223 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3M4XXE1 |
| Locus tag | OQB64_RS05050 | Protein ID | WP_003345999.1 |
| Coordinates | 1111223..1111453 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQB64_RS05015 (OQB64_05015) | 1105839..1106288 | - | 450 | WP_024649228.1 | DUF2384 domain-containing protein | - |
| OQB64_RS05020 (OQB64_05020) | 1106554..1107558 | + | 1005 | WP_004419200.1 | response regulator | - |
| OQB64_RS05025 (OQB64_05025) | 1107562..1108044 | + | 483 | WP_024649227.1 | PAS domain-containing protein | - |
| OQB64_RS05030 (OQB64_05030) | 1108141..1109397 | + | 1257 | WP_004402530.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| OQB64_RS05035 (OQB64_05035) | 1109420..1110082 | - | 663 | WP_003408532.1 | ChrR family anti-sigma-E factor | - |
| OQB64_RS05040 (OQB64_05040) | 1110082..1110594 | - | 513 | WP_003345995.1 | sigma-70 family RNA polymerase sigma factor | - |
| OQB64_RS05045 (OQB64_05045) | 1110819..1111223 | - | 405 | WP_003345997.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OQB64_RS05050 (OQB64_05050) | 1111223..1111453 | - | 231 | WP_003345999.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OQB64_RS05055 (OQB64_05055) | 1111570..1112451 | - | 882 | WP_024649226.1 | aldose 1-epimerase | - |
| OQB64_RS05060 (OQB64_05060) | 1112426..1113397 | - | 972 | WP_024649225.1 | DMT family transporter | - |
| OQB64_RS05065 (OQB64_05065) | 1113482..1114762 | - | 1281 | WP_003421655.1 | TRAP transporter large permease | - |
| OQB64_RS05070 (OQB64_05070) | 1114763..1115290 | - | 528 | WP_024649224.1 | TRAP transporter small permease | - |
| OQB64_RS05075 (OQB64_05075) | 1115354..1116379 | - | 1026 | WP_024649223.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14946.21 Da Isoelectric Point: 6.8620
>T264281 WP_003345997.1 NZ_CP110809:c1111223-1110819 [Pseudomonas syringae]
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARSGTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARSGTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A193SM35 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M4XXE1 |