Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5273982..5274593 | Replicon | chromosome |
Accession | NZ_CP110807 | ||
Organism | Pseudomonas syringae strain MUP17 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q4ZME8 |
Locus tag | OQB66_RS22640 | Protein ID | WP_003304103.1 |
Coordinates | 5273982..5274332 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q4ZME7 |
Locus tag | OQB66_RS22645 | Protein ID | WP_002556076.1 |
Coordinates | 5274345..5274593 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB66_RS22615 (OQB66_22615) | 5269091..5269933 | + | 843 | WP_266065036.1 | phage replication protein | - |
OQB66_RS22620 (OQB66_22620) | 5270000..5270290 | + | 291 | WP_003422698.1 | TraK family protein | - |
OQB66_RS22625 (OQB66_22625) | 5270569..5270943 | + | 375 | WP_003316229.1 | conjugal transfer transcriptional regulator TraJ | - |
OQB66_RS22630 (OQB66_22630) | 5270986..5271741 | + | 756 | WP_266065039.1 | P-type conjugative transfer protein TrbJ | - |
OQB66_RS22635 (OQB66_22635) | 5271945..5273330 | + | 1386 | WP_003422693.1 | P-type conjugative transfer protein TrbL | - |
OQB66_RS22640 (OQB66_22640) | 5273982..5274332 | - | 351 | WP_003304103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQB66_RS22645 (OQB66_22645) | 5274345..5274593 | - | 249 | WP_002556076.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OQB66_RS22650 (OQB66_22650) | 5274930..5275892 | + | 963 | WP_004415744.1 | tyrosine-type recombinase/integrase | - |
OQB66_RS22655 (OQB66_22655) | 5276018..5276278 | - | 261 | WP_266065044.1 | hypothetical protein | - |
OQB66_RS22660 (OQB66_22660) | 5276544..5276759 | - | 216 | WP_003316224.1 | hypothetical protein | - |
OQB66_RS22665 (OQB66_22665) | 5276952..5277410 | - | 459 | WP_003429427.1 | helix-turn-helix domain-containing protein | - |
OQB66_RS22670 (OQB66_22670) | 5277507..5278454 | + | 948 | WP_003173940.1 | aromatic alcohol reductase | - |
OQB66_RS22675 (OQB66_22675) | 5278648..5278968 | - | 321 | WP_025168236.1 | hypothetical protein | - |
OQB66_RS22680 (OQB66_22680) | 5279015..5279290 | - | 276 | WP_025168237.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5268868..5281313 | 12445 | |
- | inside | Prophage | - | - | 5192139..5275892 | 83753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12973.76 Da Isoelectric Point: 4.7690
>T264278 WP_003304103.1 NZ_CP110807:c5274332-5273982 [Pseudomonas syringae]
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
MNTFALRFTDVAQQSLEDQVEHLAVHQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSHQLSELGVLHYRELNTDGYRIFY
EVRDAGDINVIVVALVLGSKQSVEQALIRYCLLQAI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GDS9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GM89 |