Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 4318114..4318576 | Replicon | chromosome |
Accession | NZ_CP110807 | ||
Organism | Pseudomonas syringae strain MUP17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OQB66_RS18310 | Protein ID | WP_003319672.1 |
Coordinates | 4318295..4318576 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3M3EVK6 |
Locus tag | OQB66_RS18305 | Protein ID | WP_003319671.1 |
Coordinates | 4318114..4318305 (+) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB66_RS18285 (OQB66_18285) | 4313191..4314453 | - | 1263 | WP_266064603.1 | MFS transporter | - |
OQB66_RS18290 (OQB66_18290) | 4314560..4315453 | + | 894 | WP_266064604.1 | LysR family transcriptional regulator | - |
OQB66_RS18295 (OQB66_18295) | 4315469..4316581 | - | 1113 | WP_266064605.1 | hypothetical protein | - |
OQB66_RS18300 (OQB66_18300) | 4316741..4318051 | + | 1311 | WP_266064607.1 | mechanosensitive ion channel family protein | - |
OQB66_RS18305 (OQB66_18305) | 4318114..4318305 | + | 192 | WP_003319671.1 | hypothetical protein | Antitoxin |
OQB66_RS18310 (OQB66_18310) | 4318295..4318576 | + | 282 | WP_003319672.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQB66_RS18315 (OQB66_18315) | 4318852..4320972 | + | 2121 | WP_198721727.1 | alpha/beta hydrolase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4318114..4332951 | 14837 | |
- | inside | Genomic island | - | - | 4318114..4334554 | 16440 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10523.23 Da Isoelectric Point: 9.7426
>T264277 WP_003319672.1 NZ_CP110807:4318295-4318576 [Pseudomonas syringae]
MLVEWRPAARMNLKQILSYIADRNIRAASELGMAIEVATSALPQHPYLYRHGRVPGTREIVVHPNYLVVYKVTDRIEVLA
VLHARQAYPTDAG
MLVEWRPAARMNLKQILSYIADRNIRAASELGMAIEVATSALPQHPYLYRHGRVPGTREIVVHPNYLVVYKVTDRIEVLA
VLHARQAYPTDAG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|