Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4266375..4266998 | Replicon | chromosome |
Accession | NZ_CP110807 | ||
Organism | Pseudomonas syringae strain MUP17 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3M3C685 |
Locus tag | OQB66_RS18035 | Protein ID | WP_003314536.1 |
Coordinates | 4266816..4266998 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A3M3C5W4 |
Locus tag | OQB66_RS18030 | Protein ID | WP_010421644.1 |
Coordinates | 4266375..4266779 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB66_RS18015 (OQB66_18015) | 4262141..4262809 | + | 669 | WP_004416701.1 | ABC transporter ATP-binding protein | - |
OQB66_RS18020 (OQB66_18020) | 4262809..4265289 | + | 2481 | WP_046719103.1 | ABC transporter permease | - |
OQB66_RS18025 (OQB66_18025) | 4265279..4266358 | + | 1080 | WP_266064573.1 | lipocalin-like domain-containing protein | - |
OQB66_RS18030 (OQB66_18030) | 4266375..4266779 | - | 405 | WP_010421644.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OQB66_RS18035 (OQB66_18035) | 4266816..4266998 | - | 183 | WP_003314536.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OQB66_RS18040 (OQB66_18040) | 4267283..4269055 | + | 1773 | WP_266064575.1 | N-acetylglutaminylglutamine amidotransferase | - |
OQB66_RS18045 (OQB66_18045) | 4269059..4270807 | + | 1749 | WP_003418255.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6763.96 Da Isoelectric Point: 10.6643
>T264276 WP_003314536.1 NZ_CP110807:c4266998-4266816 [Pseudomonas syringae]
VQSRQLIKELEADGWVLDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
VQSRQLIKELEADGWVLDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14568.66 Da Isoelectric Point: 5.5960
>AT264276 WP_010421644.1 NZ_CP110807:c4266779-4266375 [Pseudomonas syringae]
MKYPMCIEWGNETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAASGRTIPKAGNVAEHARNPDFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPMCIEWGNETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAASGRTIPKAGNVAEHARNPDFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIRQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3C685 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3C5W4 |