Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RHH |
Location | 1996937..1997450 | Replicon | chromosome |
Accession | NZ_CP110807 | ||
Organism | Pseudomonas syringae strain MUP17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0P9GC66 |
Locus tag | OQB66_RS08970 | Protein ID | WP_003423365.1 |
Coordinates | 1996937..1997221 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0P9IXK3 |
Locus tag | OQB66_RS08975 | Protein ID | WP_004418474.1 |
Coordinates | 1997211..1997450 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQB66_RS08955 (OQB66_08955) | 1992937..1994865 | + | 1929 | WP_016567635.1 | methyl-accepting chemotaxis protein | - |
OQB66_RS08960 (OQB66_08960) | 1995041..1995973 | - | 933 | WP_266066879.1 | DMT family transporter | - |
OQB66_RS08965 (OQB66_08965) | 1996048..1996902 | + | 855 | WP_029572166.1 | LysR family transcriptional regulator | - |
OQB66_RS08970 (OQB66_08970) | 1996937..1997221 | - | 285 | WP_003423365.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQB66_RS08975 (OQB66_08975) | 1997211..1997450 | - | 240 | WP_004418474.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OQB66_RS08980 (OQB66_08980) | 1997610..1998626 | - | 1017 | WP_003423368.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
OQB66_RS08985 (OQB66_08985) | 1998813..1999319 | + | 507 | WP_003315203.1 | Lrp/AsnC family transcriptional regulator | - |
OQB66_RS08990 (OQB66_08990) | 1999466..2000374 | + | 909 | WP_003423371.1 | DUF808 domain-containing protein | - |
OQB66_RS08995 (OQB66_08995) | 2000551..2001336 | - | 786 | WP_003396313.1 | outer membrane protein OmpK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10632.34 Da Isoelectric Point: 10.4249
>T264275 WP_003423365.1 NZ_CP110807:c1997221-1996937 [Pseudomonas syringae]
MQVEWLKTALKNLDEEAAYIALDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHTRRQSPPVW
MQVEWLKTALKNLDEEAAYIALDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHTRRQSPPVW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9GC66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9IXK3 |