Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1052076..1052710 Replicon chromosome
Accession NZ_CP110807
Organism Pseudomonas syringae strain MUP17

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OQB66_RS04580 Protein ID WP_003421649.1
Coordinates 1052076..1052480 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A0P9J133
Locus tag OQB66_RS04585 Protein ID WP_003421652.1
Coordinates 1052480..1052710 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQB66_RS04550 (OQB66_04550) 1047096..1047545 - 450 WP_003421643.1 DUF2384 domain-containing protein -
OQB66_RS04555 (OQB66_04555) 1047811..1048815 + 1005 WP_266065799.1 response regulator -
OQB66_RS04560 (OQB66_04560) 1048819..1049301 + 483 WP_003345989.1 PAS domain-containing protein -
OQB66_RS04565 (OQB66_04565) 1049398..1050654 + 1257 WP_266065800.1 3-phosphoshikimate 1-carboxyvinyltransferase -
OQB66_RS04570 (OQB66_04570) 1050677..1051339 - 663 WP_003421647.1 ChrR family anti-sigma-E factor -
OQB66_RS04575 (OQB66_04575) 1051339..1051851 - 513 WP_025168157.1 sigma-70 family RNA polymerase sigma factor -
OQB66_RS04580 (OQB66_04580) 1052076..1052480 - 405 WP_003421649.1 tRNA(fMet)-specific endonuclease VapC Toxin
OQB66_RS04585 (OQB66_04585) 1052480..1052710 - 231 WP_003421652.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OQB66_RS04590 (OQB66_04590) 1052827..1053708 - 882 WP_003421653.1 aldose 1-epimerase -
OQB66_RS04595 (OQB66_04595) 1053683..1054663 - 981 WP_266065801.1 EamA family transporter -
OQB66_RS04600 (OQB66_04600) 1054748..1056028 - 1281 WP_003421655.1 TRAP transporter large permease -
OQB66_RS04605 (OQB66_04605) 1056029..1056556 - 528 WP_003408544.1 TRAP transporter small permease -
OQB66_RS04610 (OQB66_04610) 1056620..1057645 - 1026 WP_266065802.1 TRAP transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15006.27 Da        Isoelectric Point: 6.8620

>T264274 WP_003421649.1 NZ_CP110807:c1052480-1052076 [Pseudomonas syringae]
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTTRLEVLPYDSDAAAHT
GMIRAELARSSTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8508.52 Da        Isoelectric Point: 4.7247

>AT264274 WP_003421652.1 NZ_CP110807:c1052710-1052480 [Pseudomonas syringae]
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAERGQPAEQQRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0P9J133

References