Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 4178300..4178967 | Replicon | chromosome |
Accession | NZ_CP110806 | ||
Organism | Cellulomonas sp. S1-8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OKX07_RS18815 | Protein ID | WP_265629529.1 |
Coordinates | 4178300..4178692 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OKX07_RS18820 | Protein ID | WP_265629530.1 |
Coordinates | 4178695..4178967 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKX07_RS18790 (OKX07_18790) | 4174018..4174242 | - | 225 | WP_265629524.1 | hypothetical protein | - |
OKX07_RS18795 (OKX07_18795) | 4174455..4174703 | + | 249 | WP_265629525.1 | hypothetical protein | - |
OKX07_RS18800 (OKX07_18800) | 4174770..4175033 | - | 264 | WP_265629526.1 | alpha-mannosidase | - |
OKX07_RS18805 (OKX07_18805) | 4175056..4175712 | - | 657 | WP_265629527.1 | hypothetical protein | - |
OKX07_RS18810 (OKX07_18810) | 4175763..4178057 | - | 2295 | WP_265629528.1 | hypothetical protein | - |
OKX07_RS18815 (OKX07_18815) | 4178300..4178692 | - | 393 | WP_265629529.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OKX07_RS18820 (OKX07_18820) | 4178695..4178967 | - | 273 | WP_265629530.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
OKX07_RS18825 (OKX07_18825) | 4179071..4179907 | - | 837 | WP_265629531.1 | EI24 domain-containing protein | - |
OKX07_RS18830 (OKX07_18830) | 4179935..4181290 | - | 1356 | WP_265631961.1 | APC family permease | - |
OKX07_RS18835 (OKX07_18835) | 4181674..4181829 | + | 156 | WP_265629532.1 | hypothetical protein | - |
OKX07_RS18840 (OKX07_18840) | 4181826..4183274 | + | 1449 | WP_265629533.1 | basic amino acid/polyamine antiporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13922.97 Da Isoelectric Point: 5.9728
>T264273 WP_265629529.1 NZ_CP110806:c4178692-4178300 [Cellulomonas sp. S1-8]
VAHYLDTSALVKLVVEESETAALRTWWRSHGSTPVACDLVRTELMRAVRRAAPHAAVQAHRVLDALVLLSVTSRVFEVAG
RLEPTTLRSLDAIHVAAALELGDDLEGLVTYDDRLAVAASAYGIAVLAPA
VAHYLDTSALVKLVVEESETAALRTWWRSHGSTPVACDLVRTELMRAVRRAAPHAAVQAHRVLDALVLLSVTSRVFEVAG
RLEPTTLRSLDAIHVAAALELGDDLEGLVTYDDRLAVAASAYGIAVLAPA
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|