Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpK-mazE/MazF(toxin) |
Location | 4102838..4103418 | Replicon | chromosome |
Accession | NZ_CP110806 | ||
Organism | Cellulomonas sp. S1-8 |
Toxin (Protein)
Gene name | chpK | Uniprot ID | - |
Locus tag | OKX07_RS18475 | Protein ID | WP_265629462.1 |
Coordinates | 4103077..4103418 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OKX07_RS18470 | Protein ID | WP_265629461.1 |
Coordinates | 4102838..4103080 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKX07_RS18445 (OKX07_18445) | 4098407..4099345 | - | 939 | WP_265629457.1 | CPBP family intramembrane metalloprotease | - |
OKX07_RS18450 (OKX07_18450) | 4099433..4099858 | - | 426 | WP_265629458.1 | MarR family transcriptional regulator | - |
OKX07_RS18455 (OKX07_18455) | 4099994..4101118 | + | 1125 | WP_265629459.1 | alkene reductase | - |
OKX07_RS18460 (OKX07_18460) | 4101200..4101856 | - | 657 | WP_265629460.1 | SDR family oxidoreductase | - |
OKX07_RS18465 (OKX07_18465) | 4101856..4102647 | - | 792 | WP_265631959.1 | SDR family oxidoreductase | - |
OKX07_RS18470 (OKX07_18470) | 4102838..4103080 | + | 243 | WP_265629461.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
OKX07_RS18475 (OKX07_18475) | 4103077..4103418 | + | 342 | WP_265629462.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OKX07_RS18480 (OKX07_18480) | 4103468..4107136 | + | 3669 | WP_265629463.1 | TM0106 family RecB-like putative nuclease | - |
OKX07_RS18485 (OKX07_18485) | 4107191..4107733 | + | 543 | WP_265629464.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 11717.36 Da Isoelectric Point: 4.6360
>T264272 WP_265629462.1 NZ_CP110806:4103077-4103418 [Cellulomonas sp. S1-8]
VIDRGSVCWVDFGEPRGSEPGKQRPAVVVQADDFNRSAIGTVVVVPLTSNTSLAAVPGNVFVPRVASGLAKDSVANVSQV
TVASREYVTYPVASLPADLVAAIDDGLRLVLAL
VIDRGSVCWVDFGEPRGSEPGKQRPAVVVQADDFNRSAIGTVVVVPLTSNTSLAAVPGNVFVPRVASGLAKDSVANVSQV
TVASREYVTYPVASLPADLVAAIDDGLRLVLAL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|