Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 647928..648598 | Replicon | chromosome |
Accession | NZ_CP110806 | ||
Organism | Cellulomonas sp. S1-8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OKX07_RS03045 | Protein ID | WP_265630394.1 |
Coordinates | 647928..648329 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OKX07_RS03050 | Protein ID | WP_265630395.1 |
Coordinates | 648326..648598 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKX07_RS03020 (OKX07_03020) | 643585..644343 | - | 759 | WP_265630389.1 | LysR substrate-binding domain-containing protein | - |
OKX07_RS03025 (OKX07_03025) | 644340..645071 | - | 732 | WP_265630390.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
OKX07_RS03030 (OKX07_03030) | 645095..645874 | - | 780 | WP_265630391.1 | VOC family protein | - |
OKX07_RS03035 (OKX07_03035) | 646006..647019 | - | 1014 | WP_265630392.1 | alpha/beta hydrolase | - |
OKX07_RS03040 (OKX07_03040) | 647154..647810 | - | 657 | WP_265630393.1 | histidine phosphatase family protein | - |
OKX07_RS03045 (OKX07_03045) | 647928..648329 | - | 402 | WP_265630394.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OKX07_RS03050 (OKX07_03050) | 648326..648598 | - | 273 | WP_265630395.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OKX07_RS03055 (OKX07_03055) | 648756..651353 | + | 2598 | WP_265630396.1 | ATP-dependent chaperone ClpB | - |
OKX07_RS03060 (OKX07_03060) | 651499..652197 | + | 699 | WP_265630397.1 | DedA family protein | - |
OKX07_RS03065 (OKX07_03065) | 652204..652689 | - | 486 | WP_265630398.1 | septum formation family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14401.33 Da Isoelectric Point: 4.9529
>T264269 WP_265630394.1 NZ_CP110806:c648329-647928 [Cellulomonas sp. S1-8]
VIVDTSAVVAILLGEPGADELVRSVLADPRPRMSAPTFVELSAVVAQKGAPQQRRRVESLLERLGIEVVAMTPEHARIAA
DAYRELGRGSGHPARLNLGDCFSYALATEQDEPLLFVGDDFSHTDLRPARARD
VIVDTSAVVAILLGEPGADELVRSVLADPRPRMSAPTFVELSAVVAQKGAPQQRRRVESLLERLGIEVVAMTPEHARIAA
DAYRELGRGSGHPARLNLGDCFSYALATEQDEPLLFVGDDFSHTDLRPARARD
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|