Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 856..1457 | Replicon | plasmid unnamed2 |
Accession | NZ_CP110801 | ||
Organism | Lactiplantibacillus plantarum strain BRD_L15 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q684P1 |
Locus tag | OP868_RS15340 | Protein ID | WP_001748110.1 |
Coordinates | 856..1200 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | Q684P2 |
Locus tag | OP868_RS15345 | Protein ID | WP_003643337.1 |
Coordinates | 1194..1457 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP868_RS15335 (OP868_15335) | 1..5669 | - | 5669 | WP_003587210.1 | DNA starvation/stationary phase protection protein | - |
OP868_RS15340 (OP868_15340) | 856..1200 | - | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OP868_RS15345 (OP868_15345) | 1194..1457 | - | 264 | WP_003643337.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OP868_RS15350 (OP868_15350) | 1543..2130 | + | 588 | WP_103758603.1 | site-specific integrase | - |
OP868_RS15355 (OP868_15355) | 4213..4383 | - | 171 | WP_157949630.1 | hypothetical protein | - |
OP868_RS15360 (OP868_15360) | 4661..5164 | - | 504 | WP_103758604.1 | DUF536 domain-containing protein | - |
OP868_RS15365 (OP868_15365) | 5390..5479 | + | 90 | Protein_6 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..5669 | 5669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T264267 WP_001748110.1 NZ_CP110801:c1200-856 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R2K1X3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L4ZZT2 |