Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3447058..3447730 | Replicon | chromosome |
| Accession | NZ_CP110791 | ||
| Organism | Yersinia sp. SCPM-O-B-9106 (C-191) | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A386HHD1 |
| Locus tag | OP863_RS15750 | Protein ID | WP_038631074.1 |
| Coordinates | 3447058..3447483 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A386HHJ6 |
| Locus tag | OP863_RS15755 | Protein ID | WP_038631072.1 |
| Coordinates | 3447464..3447730 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP863_RS15730 (OP863_15730) | 3442816..3443334 | + | 519 | WP_265525523.1 | flavodoxin FldB | - |
| OP863_RS15735 (OP863_15735) | 3443408..3444829 | - | 1422 | WP_265525524.1 | cell envelope integrity protein CreD | - |
| OP863_RS15740 (OP863_15740) | 3444922..3446349 | - | 1428 | WP_145589604.1 | two-component system sensor histidine kinase CreC | - |
| OP863_RS15745 (OP863_15745) | 3446360..3447058 | - | 699 | WP_265525525.1 | two-component system response regulator CreB | - |
| OP863_RS15750 (OP863_15750) | 3447058..3447483 | - | 426 | WP_038631074.1 | protein YgfX | Toxin |
| OP863_RS15755 (OP863_15755) | 3447464..3447730 | - | 267 | WP_038631072.1 | FAD assembly factor SdhE | Antitoxin |
| OP863_RS15760 (OP863_15760) | 3447997..3448989 | + | 993 | WP_265525526.1 | tRNA-modifying protein YgfZ | - |
| OP863_RS15765 (OP863_15765) | 3449038..3449721 | - | 684 | WP_038631068.1 | hemolysin III family protein | - |
| OP863_RS15770 (OP863_15770) | 3450098..3450700 | + | 603 | WP_145589608.1 | HD domain-containing protein | - |
| OP863_RS15775 (OP863_15775) | 3450713..3451462 | - | 750 | WP_050292113.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16459.32 Da Isoelectric Point: 10.1175
>T264264 WP_038631074.1 NZ_CP110791:c3447483-3447058 [Yersinia sp. SCPM-O-B-9106 (C-191)]
VAQWRCDLRVSWHTQLFSLLAHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNIKSCQGEIRLKPGNVVLWKRH
EWVVVKQPWITRYGVLLSLQQTSNRSTRKRLWLAADSMPEEEWRQLCLLLRHSFGSDEGIN
VAQWRCDLRVSWHTQLFSLLAHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNIKSCQGEIRLKPGNVVLWKRH
EWVVVKQPWITRYGVLLSLQQTSNRSTRKRLWLAADSMPEEEWRQLCLLLRHSFGSDEGIN
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|