Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3126276..3126894 | Replicon | chromosome |
| Accession | NZ_CP110791 | ||
| Organism | Yersinia sp. SCPM-O-B-9106 (C-191) | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | OP863_RS14280 | Protein ID | WP_002208622.1 |
| Coordinates | 3126691..3126894 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | OP863_RS14275 | Protein ID | WP_265525443.1 |
| Coordinates | 3126276..3126644 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP863_RS14245 (OP863_14245) | 3121950..3122210 | + | 261 | WP_038631547.1 | type B 50S ribosomal protein L31 | - |
| OP863_RS14250 (OP863_14250) | 3122226..3122369 | + | 144 | WP_050113290.1 | type B 50S ribosomal protein L36 | - |
| OP863_RS14255 (OP863_14255) | 3122491..3123369 | - | 879 | WP_145589724.1 | metal ABC transporter substrate-binding protein | - |
| OP863_RS14260 (OP863_14260) | 3123415..3124272 | - | 858 | WP_038631544.1 | metal ABC transporter permease | - |
| OP863_RS14265 (OP863_14265) | 3124269..3124997 | - | 729 | WP_038631543.1 | ABC transporter ATP-binding protein | - |
| OP863_RS14270 (OP863_14270) | 3125764..3126117 | + | 354 | WP_265525442.1 | hypothetical protein | - |
| OP863_RS14275 (OP863_14275) | 3126276..3126644 | + | 369 | WP_265525443.1 | Hha toxicity modulator TomB | Antitoxin |
| OP863_RS14280 (OP863_14280) | 3126691..3126894 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| OP863_RS14290 (OP863_14290) | 3127838..3128149 | + | 312 | WP_186368264.1 | MGMT family protein | - |
| OP863_RS14295 (OP863_14295) | 3128193..3128717 | - | 525 | WP_145589727.1 | YbaY family lipoprotein | - |
| OP863_RS14300 (OP863_14300) | 3128975..3129835 | + | 861 | WP_038631531.1 | acyl-CoA thioesterase II | - |
| OP863_RS14305 (OP863_14305) | 3129917..3131206 | - | 1290 | WP_038639390.1 | ammonium transporter AmtB | - |
| OP863_RS14310 (OP863_14310) | 3131246..3131584 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T264263 WP_002208622.1 NZ_CP110791:3126691-3126894 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14219.03 Da Isoelectric Point: 4.5140
>AT264263 WP_265525443.1 NZ_CP110791:3126276-3126644 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGVDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGVDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|