Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3616661..3617280 | Replicon | chromosome |
| Accession | NZ_CP110790 | ||
| Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | OP862_RS16455 | Protein ID | WP_002208622.1 |
| Coordinates | 3617077..3617280 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | OP862_RS16450 | Protein ID | WP_167311201.1 |
| Coordinates | 3616661..3617029 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP862_RS16420 (OP862_16420) | 3612363..3612623 | + | 261 | WP_167311200.1 | type B 50S ribosomal protein L31 | - |
| OP862_RS16425 (OP862_16425) | 3612639..3612782 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| OP862_RS16430 (OP862_16430) | 3612865..3613743 | - | 879 | WP_050082628.1 | metal ABC transporter substrate-binding protein | - |
| OP862_RS16435 (OP862_16435) | 3613772..3614629 | - | 858 | WP_050082626.1 | metal ABC transporter permease | - |
| OP862_RS16440 (OP862_16440) | 3614626..3615363 | - | 738 | WP_050286523.1 | ATP-binding cassette domain-containing protein | - |
| OP862_RS16445 (OP862_16445) | 3616149..3616502 | + | 354 | WP_050286524.1 | hypothetical protein | - |
| OP862_RS16450 (OP862_16450) | 3616661..3617029 | + | 369 | WP_167311201.1 | Hha toxicity modulator TomB | Antitoxin |
| OP862_RS16455 (OP862_16455) | 3617077..3617280 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| OP862_RS16460 (OP862_16460) | 3617993..3620566 | - | 2574 | WP_050286525.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| OP862_RS16465 (OP862_16465) | 3621221..3621643 | + | 423 | WP_050082618.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T264251 WP_002208622.1 NZ_CP110790:3617077-3617280 [Yersinia massiliensis]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14174.93 Da Isoelectric Point: 4.4314
>AT264251 WP_167311201.1 NZ_CP110790:3616661-3617029 [Yersinia massiliensis]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTAAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKAKERLFRLFSGEYICTLMKS
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTAAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKAKERLFRLFSGEYICTLMKS
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|