Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /COG5642-COG5654 |
Location | 2571358..2572327 | Replicon | chromosome |
Accession | NZ_CP110790 | ||
Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A0T9TXD8 |
Locus tag | OP862_RS11580 | Protein ID | WP_050081128.1 |
Coordinates | 2571869..2572327 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0T9TWM5 |
Locus tag | OP862_RS11575 | Protein ID | WP_050081127.1 |
Coordinates | 2571358..2571804 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP862_RS11555 (OP862_11555) | 2566970..2567680 | + | 711 | WP_050285596.1 | murein tripeptide amidase MpaA | - |
OP862_RS11560 (OP862_11560) | 2567691..2568662 | - | 972 | WP_050285593.1 | L-Ala-D/L-Glu epimerase | - |
OP862_RS11565 (OP862_11565) | 2568817..2569320 | + | 504 | WP_019209936.1 | thiol peroxidase | - |
OP862_RS11570 (OP862_11570) | 2569462..2571039 | - | 1578 | WP_050081126.1 | transcriptional regulator TyrR | - |
OP862_RS11575 (OP862_11575) | 2571358..2571804 | + | 447 | WP_050081127.1 | type II toxin-antitoxin system antitoxin Xre | Antitoxin |
OP862_RS11580 (OP862_11580) | 2571869..2572327 | + | 459 | WP_050081128.1 | RES family NAD+ phosphorylase | Toxin |
OP862_RS11585 (OP862_11585) | 2572354..2573415 | - | 1062 | WP_050878719.1 | YcjF family protein | - |
OP862_RS11590 (OP862_11590) | 2573412..2574809 | - | 1398 | WP_050081130.1 | YcjX family protein | - |
OP862_RS11595 (OP862_11595) | 2574790..2575029 | - | 240 | WP_019209930.1 | phage shock protein PspD | - |
OP862_RS11600 (OP862_11600) | 2575087..2575461 | - | 375 | WP_050285589.1 | envelope stress response membrane protein PspC | - |
OP862_RS11605 (OP862_11605) | 2575461..2575688 | - | 228 | WP_050285588.1 | envelope stress response membrane protein PspB | - |
OP862_RS11610 (OP862_11610) | 2575806..2576471 | - | 666 | WP_167311224.1 | phage shock protein PspA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17297.66 Da Isoelectric Point: 5.1578
>T264250 WP_050081128.1 NZ_CP110790:2571869-2572327 [Yersinia massiliensis]
MKLYRIVMRRYLASAWTGYGAEIYGGRWNHKGHSAIYLASSVSLAMLETLAHIQDSSTLSEFELFQIEIDDNNIMLLHPT
DWPIDWRNDPAPATTMDVGTEWLESESSVGLLVPSTLVPSENNMLVNPRHKDFQAYLNSVKPLPFSFDPRLK
MKLYRIVMRRYLASAWTGYGAEIYGGRWNHKGHSAIYLASSVSLAMLETLAHIQDSSTLSEFELFQIEIDDNNIMLLHPT
DWPIDWRNDPAPATTMDVGTEWLESESSVGLLVPSTLVPSENNMLVNPRHKDFQAYLNSVKPLPFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16233.65 Da Isoelectric Point: 9.1260
>AT264250 WP_050081127.1 NZ_CP110790:2571358-2571804 [Yersinia massiliensis]
MRAYHPTPTAKTGALWREIGLPASRGTILVDSIKLGFSVDVIDSIHLWAAIPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDKGKAITWMSTPIKGLGHRSPDSLLETETGALEVCDLIGRLEHGVFS
MRAYHPTPTAKTGALWREIGLPASRGTILVDSIKLGFSVDVIDSIHLWAAIPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDKGKAITWMSTPIKGLGHRSPDSLLETETGALEVCDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9TXD8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9TWM5 |