Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1035826..1036498 | Replicon | chromosome |
| Accession | NZ_CP110790 | ||
| Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0T9UGW4 |
| Locus tag | OP862_RS04510 | Protein ID | WP_050082213.1 |
| Coordinates | 1036073..1036498 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0T9UGT3 |
| Locus tag | OP862_RS04505 | Protein ID | WP_019211617.1 |
| Coordinates | 1035826..1036092 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP862_RS04490 (OP862_04490) | 1032797..1033546 | + | 750 | WP_050286433.1 | SDR family oxidoreductase | - |
| OP862_RS04495 (OP862_04495) | 1033791..1034483 | + | 693 | WP_050082335.1 | hemolysin III family protein | - |
| OP862_RS04500 (OP862_04500) | 1034569..1035558 | - | 990 | WP_050286434.1 | tRNA-modifying protein YgfZ | - |
| OP862_RS04505 (OP862_04505) | 1035826..1036092 | + | 267 | WP_019211617.1 | FAD assembly factor SdhE | Antitoxin |
| OP862_RS04510 (OP862_04510) | 1036073..1036498 | + | 426 | WP_050082213.1 | protein YgfX | Toxin |
| OP862_RS04515 (OP862_04515) | 1036498..1037196 | + | 699 | WP_050286436.1 | two-component system response regulator CreB | - |
| OP862_RS04520 (OP862_04520) | 1037235..1038662 | + | 1428 | WP_050286437.1 | two-component system sensor histidine kinase CreC | - |
| OP862_RS04525 (OP862_04525) | 1038754..1040178 | + | 1425 | WP_050286439.1 | cell envelope integrity protein CreD | - |
| OP862_RS04530 (OP862_04530) | 1040269..1040787 | - | 519 | WP_050286440.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16527.43 Da Isoelectric Point: 9.4189
>T264243 WP_050082213.1 NZ_CP110790:1036073-1036498 [Yersinia massiliensis]
VAQWRCDLRISWHTQLFSLLTHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNVVLWKRL
EWIVVKQPWMTRYGVLLRLRQANSRSTCKRLWLAADSMSEDEWRQLCLLLRHSFDADEGHT
VAQWRCDLRISWHTQLFSLLTHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNVVLWKRL
EWIVVKQPWMTRYGVLLRLRQANSRSTCKRLWLAADSMSEDEWRQLCLLLRHSFDADEGHT
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9UGW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9UGT3 |