Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 133922..134532 | Replicon | chromosome |
Accession | NZ_CP110790 | ||
Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A0T9RAE9 |
Locus tag | OP862_RS00560 | Protein ID | WP_049610048.1 |
Coordinates | 133922..134314 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0T9UY83 |
Locus tag | OP862_RS00565 | Protein ID | WP_049610050.1 |
Coordinates | 134311..134532 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP862_RS00535 (OP862_00535) | 129145..129330 | + | 186 | WP_049610039.1 | hypothetical protein | - |
OP862_RS00540 (OP862_00540) | 129536..130684 | + | 1149 | WP_050083387.1 | pectate lyase | - |
OP862_RS00545 (OP862_00545) | 130763..130942 | - | 180 | Protein_107 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
OP862_RS00550 (OP862_00550) | 130973..132583 | - | 1611 | WP_050287363.1 | FAD-NAD(P)-binding protein | - |
OP862_RS00555 (OP862_00555) | 133224..133760 | - | 537 | WP_050287364.1 | cysteine hydrolase family protein | - |
OP862_RS00560 (OP862_00560) | 133922..134314 | - | 393 | WP_049610048.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OP862_RS00565 (OP862_00565) | 134311..134532 | - | 222 | WP_049610050.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OP862_RS00570 (OP862_00570) | 134782..135645 | - | 864 | WP_050287365.1 | YicC/YloC family endoribonuclease | - |
OP862_RS00575 (OP862_00575) | 135775..136491 | + | 717 | WP_004705100.1 | ribonuclease PH | - |
OP862_RS00580 (OP862_00580) | 136603..137250 | + | 648 | WP_049610089.1 | orotate phosphoribosyltransferase | - |
OP862_RS00585 (OP862_00585) | 137700..138995 | + | 1296 | WP_050083382.1 | dicarboxylate/amino acid:cation symporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14797.78 Da Isoelectric Point: 6.9895
>T264242 WP_049610048.1 NZ_CP110790:c134314-133922 [Yersinia massiliensis]
MMWISAQEVIAFHDRILQRLPGVTGIPDPGRAEALIYRVQNRTHYEGVTDVFELGATYWVAIARGHIFNDGNKRTAFFVT
MAFLYRNGIRIRDTDNSLENLTVAAATGEKTVDQLAQHLRDLVEHTNQIR
MMWISAQEVIAFHDRILQRLPGVTGIPDPGRAEALIYRVQNRTHYEGVTDVFELGATYWVAIARGHIFNDGNKRTAFFVT
MAFLYRNGIRIRDTDNSLENLTVAAATGEKTVDQLAQHLRDLVEHTNQIR
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9RAE9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9UY83 |