Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 48074..48717 | Replicon | chromosome |
Accession | NZ_CP110790 | ||
Organism | Yersinia massiliensis strain SCPM-O-B-8026 (C-146) |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A0T9UYT7 |
Locus tag | OP862_RS00190 | Protein ID | WP_072084841.1 |
Coordinates | 48074..48493 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A0T9UYU4 |
Locus tag | OP862_RS00195 | Protein ID | WP_049611185.1 |
Coordinates | 48490..48717 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP862_RS00170 (OP862_00170) | 43167..44021 | + | 855 | WP_167311513.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
OP862_RS00175 (OP862_00175) | 44148..44771 | + | 624 | WP_167311514.1 | superoxide dismutase [Mn] | - |
OP862_RS00180 (OP862_00180) | 45093..47054 | + | 1962 | WP_050287201.1 | methyl-accepting chemotaxis protein | - |
OP862_RS00185 (OP862_00185) | 47224..47898 | + | 675 | WP_050083410.1 | 6-hydroxyaminopurine reductase | - |
OP862_RS00190 (OP862_00190) | 48074..48493 | - | 420 | WP_072084841.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OP862_RS00195 (OP862_00195) | 48490..48717 | - | 228 | WP_049611185.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OP862_RS00200 (OP862_00200) | 48891..49247 | - | 357 | WP_050083411.1 | YibL family ribosome-associated protein | - |
OP862_RS00205 (OP862_00205) | 49412..50893 | - | 1482 | WP_050083412.1 | PLP-dependent aminotransferase family protein | - |
OP862_RS00210 (OP862_00210) | 51115..51723 | + | 609 | WP_050083413.1 | LysE family translocator | - |
OP862_RS00215 (OP862_00215) | 51725..52279 | - | 555 | WP_019212698.1 | MltR family transcriptional regulator | - |
OP862_RS00220 (OP862_00220) | 52358..53521 | - | 1164 | WP_050287203.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15480.16 Da Isoelectric Point: 9.5045
>T264240 WP_072084841.1 NZ_CP110790:c48493-48074 [Yersinia massiliensis]
MIKKIYMLDTNICSFIMRERPAEIIIKLQQCIERQNKIVVSAITYSEMRFGAIGKKASPKHTYLVEEFVKRLDAVLPWDV
AAIDATTQIKIALAKAGTPIGGNDAAIAGHAISTGAILVTNNVREFERVKKLHIEDWAN
MIKKIYMLDTNICSFIMRERPAEIIIKLQQCIERQNKIVVSAITYSEMRFGAIGKKASPKHTYLVEEFVKRLDAVLPWDV
AAIDATTQIKIALAKAGTPIGGNDAAIAGHAISTGAILVTNNVREFERVKKLHIEDWAN
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9UYT7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9UYU4 |