Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3574557..3575176 | Replicon | chromosome |
| Accession | NZ_CP110789 | ||
| Organism | Yersinia intermedia strain SCPM-O-B-10209 (333) | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | OP861_RS16485 | Protein ID | WP_002208622.1 |
| Coordinates | 3574973..3575176 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | OP861_RS16480 | Protein ID | WP_265534982.1 |
| Coordinates | 3574557..3574925 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP861_RS16450 (OP861_16450) | 3570189..3570461 | + | 273 | WP_265534977.1 | type B 50S ribosomal protein L31 | - |
| OP861_RS16455 (OP861_16455) | 3570464..3570607 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| OP861_RS16460 (OP861_16460) | 3570774..3571652 | - | 879 | WP_005182278.1 | metal ABC transporter substrate-binding protein | - |
| OP861_RS16465 (OP861_16465) | 3571681..3572538 | - | 858 | WP_050086000.1 | metal ABC transporter permease | - |
| OP861_RS16470 (OP861_16470) | 3572535..3573272 | - | 738 | WP_050086076.1 | ABC transporter ATP-binding protein | - |
| OP861_RS16475 (OP861_16475) | 3574045..3574398 | + | 354 | WP_050086001.1 | hypothetical protein | - |
| OP861_RS16480 (OP861_16480) | 3574557..3574925 | + | 369 | WP_265534982.1 | Hha toxicity modulator TomB | Antitoxin |
| OP861_RS16485 (OP861_16485) | 3574973..3575176 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| OP861_RS16495 (OP861_16495) | 3576106..3576411 | + | 306 | WP_186004081.1 | MGMT family protein | - |
| OP861_RS16500 (OP861_16500) | 3576502..3577056 | - | 555 | WP_226717834.1 | YbaY family lipoprotein | - |
| OP861_RS16505 (OP861_16505) | 3577315..3578175 | + | 861 | WP_226717835.1 | acyl-CoA thioesterase II | - |
| OP861_RS16510 (OP861_16510) | 3578266..3579555 | - | 1290 | WP_050135642.1 | ammonium transporter AmtB | - |
| OP861_RS16515 (OP861_16515) | 3579595..3579933 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T264239 WP_002208622.1 NZ_CP110789:3574973-3575176 [Yersinia intermedia]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14188.91 Da Isoelectric Point: 4.4314
>AT264239 WP_265534982.1 NZ_CP110789:3574557-3574925 [Yersinia intermedia]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLLRLFSGEYTCTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKERLLRLFSGEYTCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|