Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1235189..1235724 | Replicon | chromosome |
| Accession | NZ_CP110789 | ||
| Organism | Yersinia intermedia strain SCPM-O-B-10209 (333) | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OP861_RS05540 | Protein ID | WP_265535698.1 |
| Coordinates | 1235437..1235724 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A209ACY9 |
| Locus tag | OP861_RS05535 | Protein ID | WP_050084811.1 |
| Coordinates | 1235189..1235440 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP861_RS05510 (OP861_05510) | 1230616..1231119 | + | 504 | WP_050084806.1 | ferredoxin-type protein NapF | - |
| OP861_RS05515 (OP861_05515) | 1231109..1231375 | + | 267 | WP_032905977.1 | chaperone NapD | - |
| OP861_RS05520 (OP861_05520) | 1231372..1233867 | + | 2496 | WP_050133149.1 | nitrate reductase catalytic subunit NapA | - |
| OP861_RS05525 (OP861_05525) | 1233963..1234430 | + | 468 | WP_050084809.1 | nitrate reductase cytochrome c-type subunit | - |
| OP861_RS05530 (OP861_05530) | 1234459..1235058 | + | 600 | WP_042568393.1 | cytochrome c-type protein NapC | - |
| OP861_RS05535 (OP861_05535) | 1235189..1235440 | + | 252 | WP_050084811.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OP861_RS05540 (OP861_05540) | 1235437..1235724 | + | 288 | WP_265535698.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OP861_RS05545 (OP861_05545) | 1235754..1236329 | + | 576 | WP_050084918.1 | GDP-mannose pyrophosphatase NudK | - |
| OP861_RS05550 (OP861_05550) | 1236665..1238944 | + | 2280 | WP_005183822.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
| OP861_RS05555 (OP861_05555) | 1239123..1239581 | - | 459 | WP_050084816.1 | YaiI/YqxD family protein | - |
| OP861_RS05560 (OP861_05560) | 1239581..1240507 | - | 927 | WP_226715690.1 | oxygen-dependent coproporphyrinogen oxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11042.98 Da Isoelectric Point: 10.5833
>T264232 WP_265535698.1 NZ_CP110789:1235437-1235724 [Yersinia intermedia]
MTYAVKFREEALKEWHKLNKTIQQQFAKKLKKCSDNPHIESAKLRGMKNCYKIKLRSSGFRLVYEVIDDVLIVAVVAVGK
RDRSGVYNLASDRLR
MTYAVKFREEALKEWHKLNKTIQQQFAKKLKKCSDNPHIESAKLRGMKNCYKIKLRSSGFRLVYEVIDDVLIVAVVAVGK
RDRSGVYNLASDRLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|