Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 835549..836224 | Replicon | chromosome |
| Accession | NZ_CP110789 | ||
| Organism | Yersinia intermedia strain SCPM-O-B-10209 (333) | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A208ZYD5 |
| Locus tag | OP861_RS03700 | Protein ID | WP_050086374.1 |
| Coordinates | 835796..836224 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | OP861_RS03695 | Protein ID | WP_050086375.1 |
| Coordinates | 835549..835815 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP861_RS03675 (OP861_03675) | 831671..832420 | + | 750 | WP_050312389.1 | SDR family oxidoreductase | - |
| OP861_RS03680 (OP861_03680) | 832482..833090 | - | 609 | WP_050086377.1 | HD domain-containing protein | - |
| OP861_RS03685 (OP861_03685) | 833481..834131 | + | 651 | WP_226717746.1 | hemolysin III family protein | - |
| OP861_RS03690 (OP861_03690) | 834189..835181 | - | 993 | WP_050086376.1 | tRNA-modifying protein YgfZ | - |
| OP861_RS03695 (OP861_03695) | 835549..835815 | + | 267 | WP_050086375.1 | FAD assembly factor SdhE | Antitoxin |
| OP861_RS03700 (OP861_03700) | 835796..836224 | + | 429 | WP_050086374.1 | protein YgfX | Toxin |
| OP861_RS03705 (OP861_03705) | 836221..836916 | + | 696 | WP_050086373.1 | two-component system response regulator CreB | - |
| OP861_RS03710 (OP861_03710) | 836944..838371 | + | 1428 | WP_050882868.1 | two-component system sensor histidine kinase CreC | - |
| OP861_RS03715 (OP861_03715) | 838464..839870 | + | 1407 | WP_050086371.1 | cell envelope integrity protein CreD | - |
| OP861_RS03720 (OP861_03720) | 839921..840439 | - | 519 | WP_005185992.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16578.41 Da Isoelectric Point: 10.3815
>T264231 WP_050086374.1 NZ_CP110789:835796-836224 [Yersinia intermedia]
VAQWRCDLRVSWHTQLFSLLSHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNLVLWKRF
EWIVVKQPWITRYGVLLNLQQSSSRSARKRLWLAADSMSEDEWRQLCQLLRHSFGSDKGMNQ
VAQWRCDLRVSWHTQLFSLLSHGVLVILTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNLVLWKRF
EWIVVKQPWITRYGVLLNLQQSSSRSARKRLWLAADSMSEDEWRQLCQLLRHSFGSDKGMNQ
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|