Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 52884..53527 | Replicon | chromosome |
Accession | NZ_CP110789 | ||
Organism | Yersinia intermedia strain SCPM-O-B-10209 (333) |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A209A7J6 |
Locus tag | OP861_RS00230 | Protein ID | WP_050086921.1 |
Coordinates | 53108..53527 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | OP861_RS00225 | Protein ID | WP_050136162.1 |
Coordinates | 52884..53111 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP861_RS00200 (OP861_00200) | 48105..49268 | + | 1164 | WP_050086925.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OP861_RS00205 (OP861_00205) | 49445..49999 | + | 555 | WP_005186837.1 | MltR family transcriptional regulator | - |
OP861_RS00210 (OP861_00210) | 50001..50609 | - | 609 | WP_032906751.1 | LysE family translocator | - |
OP861_RS00215 (OP861_00215) | 50825..52306 | + | 1482 | WP_032906752.1 | PLP-dependent aminotransferase family protein | - |
OP861_RS00220 (OP861_00220) | 52399..52755 | + | 357 | WP_005186841.1 | YibL family ribosome-associated protein | - |
OP861_RS00225 (OP861_00225) | 52884..53111 | + | 228 | WP_050136162.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OP861_RS00230 (OP861_00230) | 53108..53527 | + | 420 | WP_050086921.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OP861_RS00235 (OP861_00235) | 53671..54342 | - | 672 | WP_050086918.1 | 6-hydroxyaminopurine reductase | - |
OP861_RS00240 (OP861_00240) | 54486..56447 | - | 1962 | WP_265535602.1 | methyl-accepting chemotaxis protein | - |
OP861_RS00245 (OP861_00245) | 56842..57462 | - | 621 | WP_265535603.1 | superoxide dismutase [Mn] | - |
OP861_RS00250 (OP861_00250) | 57587..58441 | - | 855 | WP_050088620.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15588.20 Da Isoelectric Point: 9.5042
>T264229 WP_050086921.1 NZ_CP110789:53108-53527 [Yersinia intermedia]
MMKRIYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILSWDA
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAISAGAILVTNNIREFERVKKLRIEDWSK
MMKRIYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILSWDA
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAISAGAILVTNNIREFERVKKLRIEDWSK
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|