Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF-doc |
Location | 8119..8702 | Replicon | plasmid unnamedA |
Accession | NZ_CP110785 | ||
Organism | Staphylococcus capitis strain CCSM0123 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OP858_RS12215 | Protein ID | WP_111412670.1 |
Coordinates | 8119..8457 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OP858_RS12220 | Protein ID | WP_070664439.1 |
Coordinates | 8454..8702 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP858_RS12190 (OP858_12190) | 5074..5511 | + | 438 | WP_070664071.1 | hypothetical protein | - |
OP858_RS12195 (OP858_12195) | 5650..6072 | - | 423 | WP_267263620.1 | IS200/IS605 family transposase | - |
OP858_RS12200 (OP858_12200) | 6171..7313 | + | 1143 | WP_267263621.1 | RNA-guided endonuclease TnpB family protein | - |
OP858_RS12205 (OP858_12205) | 7438..7608 | + | 171 | WP_165353544.1 | hypothetical protein | - |
OP858_RS12210 (OP858_12210) | 7685..8062 | + | 378 | WP_267263622.1 | hypothetical protein | - |
OP858_RS12215 (OP858_12215) | 8119..8457 | - | 339 | WP_111412670.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OP858_RS12220 (OP858_12220) | 8454..8702 | - | 249 | WP_070664439.1 | AbrB family transcriptional regulator | Antitoxin |
OP858_RS12225 (OP858_12225) | 8864..9697 | - | 834 | WP_267263623.1 | trypsin-like peptidase domain-containing protein | - |
OP858_RS12230 (OP858_12230) | 9716..10933 | - | 1218 | WP_267263624.1 | DUF5011 domain-containing protein | - |
OP858_RS12235 (OP858_12235) | 10959..11366 | - | 408 | Protein_14 | CHAP domain-containing protein | - |
OP858_RS12240 (OP858_12240) | 11579..11875 | - | 297 | WP_070664421.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..48504 | 48504 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13090.29 Da Isoelectric Point: 10.0249
>T264228 WP_111412670.1 NZ_CP110785:c8457-8119 [Staphylococcus capitis]
MSIKQFDIYYIDLDPTRGREKQKIRPCLIVNNKMTIDGTNFVWVLPITNREKRYPLDIELKTKKGLVTGVIDTLQIRALD
LSVREHNYKDKLQDNLKNVVLQAIQTYLKPSS
MSIKQFDIYYIDLDPTRGREKQKIRPCLIVNNKMTIDGTNFVWVLPITNREKRYPLDIELKTKKGLVTGVIDTLQIRALD
LSVREHNYKDKLQDNLKNVVLQAIQTYLKPSS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|