Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1901416..1901891 Replicon chromosome
Accession NZ_CP110784
Organism Staphylococcus capitis strain CCSM0123

Toxin (Protein)


Gene name TsaT Uniprot ID A0A4U9TFJ6
Locus tag OP858_RS09280 Protein ID WP_002452783.1
Coordinates 1901706..1901891 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A4U9TGN1
Locus tag OP858_RS09275 Protein ID WP_016898827.1
Coordinates 1901416..1901673 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OP858_RS09240 (OP858_09240) 1896662..1897384 - 723 WP_002452791.1 type I 3-dehydroquinate dehydratase -
OP858_RS09245 (OP858_09245) 1897554..1897976 + 423 WP_002452790.1 organic hydroperoxide resistance protein -
OP858_RS09250 (OP858_09250) 1898378..1898884 + 507 WP_267263426.1 GNAT family N-acetyltransferase -
OP858_RS09255 (OP858_09255) 1899071..1899688 + 618 WP_002452788.1 LysE/ArgO family amino acid transporter -
OP858_RS09260 (OP858_09260) 1899750..1900334 - 585 WP_267263427.1 histidine phosphatase family protein -
OP858_RS09265 (OP858_09265) 1900547..1900783 + 237 WP_002452786.1 hypothetical protein -
OP858_RS09270 (OP858_09270) 1900775..1900978 - 204 WP_002452785.1 sterile alpha motif-like domain-containing protein -
OP858_RS09275 (OP858_09275) 1901416..1901673 + 258 WP_016898827.1 hypothetical protein Antitoxin
OP858_RS09280 (OP858_09280) 1901706..1901891 + 186 WP_002452783.1 hypothetical protein Toxin
OP858_RS09285 (OP858_09285) 1902048..1902632 + 585 WP_002452782.1 lipoprotein N-acylation protein LnsA -
OP858_RS09290 (OP858_09290) 1902691..1902924 - 234 WP_002433190.1 hypothetical protein -
OP858_RS09295 (OP858_09295) 1903056..1903664 - 609 WP_049390819.1 GNAT family N-acetyltransferase -
OP858_RS09300 (OP858_09300) 1903845..1904591 + 747 WP_002452780.1 poly-gamma-glutamate hydrolase family protein -
OP858_RS09305 (OP858_09305) 1904712..1904996 + 285 WP_002452779.1 hypothetical protein -
OP858_RS09310 (OP858_09310) 1905020..1905244 + 225 WP_002452778.1 hypothetical protein -
OP858_RS09315 (OP858_09315) 1905553..1906287 - 735 WP_002452777.1 SGNH/GDSL hydrolase family protein -
OP858_RS09320 (OP858_09320) 1906416..1906616 - 201 WP_002433447.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6964.67 Da        Isoelectric Point: 10.2299

>T264225 WP_002452783.1 NZ_CP110784:1901706-1901891 [Staphylococcus capitis]
VSLHFQILLWLAIIFIVAGAIILTIMLKTKKAERKESYLGFTVIFLIFGFAMLIYTLIFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9758.84 Da        Isoelectric Point: 3.6988

>AT264225 WP_016898827.1 NZ_CP110784:1901416-1901673 [Staphylococcus capitis]
MKVFSINVINIILTILFVAFNVLITYNANVDNQLWLIPGLCICGVALFTSLIIAIIYTDLLSEILFFINIVLALYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4U9TFJ6

Antitoxin

Source ID Structure
AlphaFold DB A0A4U9TGN1

References