Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 982521..983327 | Replicon | chromosome |
Accession | NZ_CP110784 | ||
Organism | Staphylococcus capitis strain CCSM0123 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | A0A1J4EAU5 |
Locus tag | OP858_RS04880 | Protein ID | WP_002434789.1 |
Coordinates | 983148..983327 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A1J4ECT8 |
Locus tag | OP858_RS04875 | Protein ID | WP_002453580.1 |
Coordinates | 982521..983120 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP858_RS04855 (OP858_04855) | 978409..979866 | + | 1458 | WP_186334420.1 | ABC transporter substrate-binding protein/permease | - |
OP858_RS04860 (OP858_04860) | 979859..980584 | + | 726 | WP_186334421.1 | amino acid ABC transporter ATP-binding protein | - |
OP858_RS04865 (OP858_04865) | 980704..981867 | + | 1164 | WP_100209048.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
OP858_RS04870 (OP858_04870) | 981870..982340 | + | 471 | WP_002453581.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
OP858_RS04875 (OP858_04875) | 982521..983120 | + | 600 | WP_002453580.1 | glucosamine-6-phosphate isomerase | Antitoxin |
OP858_RS04880 (OP858_04880) | 983148..983327 | + | 180 | WP_002434789.1 | SAS053 family protein | Toxin |
OP858_RS04885 (OP858_04885) | 983492..983890 | + | 399 | WP_002453579.1 | hypothetical protein | - |
OP858_RS04890 (OP858_04890) | 984043..985428 | + | 1386 | WP_002453578.1 | class II fumarate hydratase | - |
OP858_RS04895 (OP858_04895) | 985526..986356 | - | 831 | WP_002453577.1 | RluA family pseudouridine synthase | - |
OP858_RS04900 (OP858_04900) | 986532..987644 | + | 1113 | WP_267263569.1 | GAF domain-containing sensor histidine kinase | - |
OP858_RS04905 (OP858_04905) | 987664..988287 | + | 624 | WP_002453575.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 7005.38 Da Isoelectric Point: 3.9242
>T264222 WP_002434789.1 NZ_CP110784:983148-983327 [Staphylococcus capitis]
MNKEHESKLNYHEEENAMVTDLDDLKELGKEMEQISEENDEDKLNQSHDEDVRSDLNNE
MNKEHESKLNYHEEENAMVTDLDDLKELGKEMEQISEENDEDKLNQSHDEDVRSDLNNE
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22720.63 Da Isoelectric Point: 4.7928
>AT264222 WP_002453580.1 NZ_CP110784:982521-983120 [Staphylococcus capitis]
MAMNFKVFENSERVAEYAADIIRKQFNNNPTTIAGFHLEKDHAPVLDELKKNVDTHAVDFSQINILDYDDNRSYYEALGV
PESQVYSISYEQDAIDFISDKMKTKENKGKLILQVLSIDESGKLDVSVRQGLMEAREIFLVVTGSNKREVIEKLYRENGK
SSYEPADLKAHRMVNVILDKEAAAGLPEDVKEYFTARYV
MAMNFKVFENSERVAEYAADIIRKQFNNNPTTIAGFHLEKDHAPVLDELKKNVDTHAVDFSQINILDYDDNRSYYEALGV
PESQVYSISYEQDAIDFISDKMKTKENKGKLILQVLSIDESGKLDVSVRQGLMEAREIFLVVTGSNKREVIEKLYRENGK
SSYEPADLKAHRMVNVILDKEAAAGLPEDVKEYFTARYV
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J4EAU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J4ECT8 |