Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 831203..831726 | Replicon | chromosome |
| Accession | NZ_CP110784 | ||
| Organism | Staphylococcus capitis strain CCSM0123 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A1J4E8Y2 |
| Locus tag | OP858_RS04025 | Protein ID | WP_002435799.1 |
| Coordinates | 831370..831726 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A1J4E747 |
| Locus tag | OP858_RS04020 | Protein ID | WP_002435513.1 |
| Coordinates | 831203..831373 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP858_RS03995 (OP858_03995) | 827030..827509 | + | 480 | WP_002453690.1 | PH domain-containing protein | - |
| OP858_RS04000 (OP858_04000) | 827502..829001 | + | 1500 | WP_002453689.1 | PH domain-containing protein | - |
| OP858_RS04005 (OP858_04005) | 828994..829494 | + | 501 | WP_002453688.1 | PH domain-containing protein | - |
| OP858_RS04010 (OP858_04010) | 829543..829899 | + | 357 | WP_002453687.1 | holo-ACP synthase | - |
| OP858_RS04015 (OP858_04015) | 829966..831114 | + | 1149 | WP_002453686.1 | alanine racemase | - |
| OP858_RS04020 (OP858_04020) | 831203..831373 | + | 171 | WP_002435513.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OP858_RS04025 (OP858_04025) | 831370..831726 | + | 357 | WP_002435799.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OP858_RS04030 (OP858_04030) | 832105..833106 | + | 1002 | WP_002453685.1 | PP2C family protein-serine/threonine phosphatase | - |
| OP858_RS04035 (OP858_04035) | 833208..833534 | + | 327 | WP_002435753.1 | anti-sigma factor antagonist | - |
| OP858_RS04040 (OP858_04040) | 833536..834015 | + | 480 | WP_002435518.1 | anti-sigma B factor RsbW | - |
| OP858_RS04045 (OP858_04045) | 833990..834760 | + | 771 | WP_002435824.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13327.44 Da Isoelectric Point: 9.8770
>T264221 WP_002435799.1 NZ_CP110784:831370-831726 [Staphylococcus capitis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALDISLGLHNFDHQ
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALDISLGLHNFDHQ
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J4E8Y2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J4E747 |