Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 32173..32816 Replicon plasmid pCf-KPC
Accession NZ_CP110778
Organism Citrobacter freundii strain Cf-Emp

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OPR78_RS26925 Protein ID WP_001044770.1
Coordinates 32173..32589 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OPR78_RS26930 Protein ID WP_001261282.1
Coordinates 32586..32816 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPR78_RS26890 (OPR78_26880) 27715..27951 - 237 WP_000993386.1 broad-spectrum mercury transporter MerE -
OPR78_RS26895 (OPR78_26885) 27948..28310 - 363 WP_001277456.1 mercury resistance co-regulator MerD -
OPR78_RS26900 (OPR78_26890) 28328..30022 - 1695 WP_000105636.1 mercury(II) reductase -
OPR78_RS26905 (OPR78_26895) 30074..30496 - 423 WP_001340589.1 organomercurial transporter MerC -
OPR78_RS26910 (OPR78_26900) 30532..30642 - 111 Protein_30 mercuric transport protein periplasmic component -
OPR78_RS26920 (OPR78_26910) 31410..32099 - 690 Protein_32 AAA family ATPase -
OPR78_RS26925 (OPR78_26915) 32173..32589 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OPR78_RS26930 (OPR78_26920) 32586..32816 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OPR78_RS26935 (OPR78_26925) 32773..33234 + 462 WP_072202616.1 hypothetical protein -
OPR78_RS26940 (OPR78_26930) 33378..33728 + 351 WP_000493378.1 hypothetical protein -
OPR78_RS26945 (OPR78_26935) 33779..34522 + 744 WP_000129823.1 hypothetical protein -
OPR78_RS26950 (OPR78_26940) 34519..35295 + 777 WP_000015958.1 site-specific integrase -
OPR78_RS26955 (OPR78_26945) 35353..35610 - 258 WP_000764642.1 hypothetical protein -
OPR78_RS26960 (OPR78_26950) 35739..35843 - 105 WP_032409716.1 hypothetical protein -
OPR78_RS26965 (OPR78_26955) 36378..37244 + 867 WP_004118283.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaOXA-9 / blaTEM-1A / mph(E) / msr(E) / armA - 1..81813 81813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T264215 WP_001044770.1 NZ_CP110778:c32589-32173 [Citrobacter freundii]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT264215 WP_001261282.1 NZ_CP110778:c32816-32586 [Citrobacter freundii]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References