Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 32173..32816 | Replicon | plasmid pCf-KPC |
| Accession | NZ_CP110778 | ||
| Organism | Citrobacter freundii strain Cf-Emp | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OPR78_RS26925 | Protein ID | WP_001044770.1 |
| Coordinates | 32173..32589 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OPR78_RS26930 | Protein ID | WP_001261282.1 |
| Coordinates | 32586..32816 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPR78_RS26890 (OPR78_26880) | 27715..27951 | - | 237 | WP_000993386.1 | broad-spectrum mercury transporter MerE | - |
| OPR78_RS26895 (OPR78_26885) | 27948..28310 | - | 363 | WP_001277456.1 | mercury resistance co-regulator MerD | - |
| OPR78_RS26900 (OPR78_26890) | 28328..30022 | - | 1695 | WP_000105636.1 | mercury(II) reductase | - |
| OPR78_RS26905 (OPR78_26895) | 30074..30496 | - | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
| OPR78_RS26910 (OPR78_26900) | 30532..30642 | - | 111 | Protein_30 | mercuric transport protein periplasmic component | - |
| OPR78_RS26920 (OPR78_26910) | 31410..32099 | - | 690 | Protein_32 | AAA family ATPase | - |
| OPR78_RS26925 (OPR78_26915) | 32173..32589 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OPR78_RS26930 (OPR78_26920) | 32586..32816 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OPR78_RS26935 (OPR78_26925) | 32773..33234 | + | 462 | WP_072202616.1 | hypothetical protein | - |
| OPR78_RS26940 (OPR78_26930) | 33378..33728 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| OPR78_RS26945 (OPR78_26935) | 33779..34522 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| OPR78_RS26950 (OPR78_26940) | 34519..35295 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| OPR78_RS26955 (OPR78_26945) | 35353..35610 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| OPR78_RS26960 (OPR78_26950) | 35739..35843 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| OPR78_RS26965 (OPR78_26955) | 36378..37244 | + | 867 | WP_004118283.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaOXA-9 / blaTEM-1A / mph(E) / msr(E) / armA | - | 1..81813 | 81813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T264215 WP_001044770.1 NZ_CP110778:c32589-32173 [Citrobacter freundii]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |