Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4595334..4595954 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OPR78_RS22595 | Protein ID | WP_002892050.1 |
Coordinates | 4595334..4595552 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | OPR78_RS22600 | Protein ID | WP_003021733.1 |
Coordinates | 4595580..4595954 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS22560 (4590567) | 4590567..4591196 | + | 630 | WP_003835929.1 | membrane protein | - |
OPR78_RS22565 (4591261) | 4591261..4591614 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
OPR78_RS22570 (4591666) | 4591666..4593219 | - | 1554 | WP_044699371.1 | EAL domain-containing protein | - |
OPR78_RS22575 (4593408) | 4593408..4593668 | + | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
OPR78_RS22580 (4593670) | 4593670..4593810 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
OPR78_RS22585 (4593889) | 4593889..4594359 | - | 471 | WP_003021724.1 | YlaC family protein | - |
OPR78_RS22590 (4594476) | 4594476..4595027 | - | 552 | WP_044699372.1 | maltose O-acetyltransferase | - |
OPR78_RS22595 (4595334) | 4595334..4595552 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OPR78_RS22600 (4595580) | 4595580..4595954 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
OPR78_RS22605 (4596442) | 4596442..4599591 | - | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
OPR78_RS22610 (4599614) | 4599614..4600807 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264213 WP_002892050.1 NZ_CP110775:c4595552-4595334 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT264213 WP_003021733.1 NZ_CP110775:c4595954-4595580 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |